KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0547Help
Entry
HDEF_0547         CDS       T00911                                 

Gene name
bioH
Definition
(GenBank) carboxylesterase in pimeloyl-CoA (biotin precursor) synthesis with alpha/beta-hydrolase domain
  KO
K02170  pimeloyl-[acyl-carrier protein] methyl ester esterase [EC:3.1.1.85]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00780  Biotin metabolism
hde01100  Metabolic pathways
Module
hde_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HDEF_0547 (bioH)
Enzymes [BR:hde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.85  pimelyl-[acyl-carrier protein] methyl ester esterase
     HDEF_0547 (bioH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 FSH1 Thioesterase Abhydrolase_2 Ndr PGAP1 Esterase
Motif
Other DBs
NCBI-ProteinID: ACQ67300
UniProt: C4K407
Position
544908..545687
Genome map
AA seq 259 aa AA seqDB search
MKNLYRYSCGEGKLDFVMLHGWGMNSNAWRYIINRFGSHFRLHLFDLPGYGFSQSEESFT
LPEISETVLKKAPPQAIWLGWSMGGCIASEIALRYPERVLALITVCSSPCFVSQHQWPRI
SWQVLSCFEQKLEDHLQNTLEQFLLLQTLGTLNSQRDTTSLKSFLFSRPLPKKEVLKAGL
KILRYTDMRDSLNAISVPFLRIYGKLDALVPCKIAELLDEAWPHTESVIMHQSAHVPFIS
HTDDFLEVILYFYQKYFSH
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacctatatagatacagctgcggcgaaggaaaactcgattttgtgatgttgcac
ggatggggaatgaattcgaatgcatggcgttacattataaacagattcggttcgcatttc
cgattgcatttatttgacctccctggctatggcttcagtcagagtgaagagagttttacc
cttcctgaaatatcagaaacggttttaaaaaaagcgccgccacaggcaatatggctaggt
tggtcaatgggcggatgcatcgccagtgagattgctctgaggtatcctgaacgtgttctt
gctttaatcacggtttgcagttctccttgttttgtttctcaacatcaatggcctagaata
tcatggcaggttttgtcgtgttttgaacaaaaattagaggatcatttacagaatacgcta
gagcaatttttattgcttcaaacattaggcacgctcaacagtcagcgagatacaacatct
ttaaaatcttttttattcagtcgacctttaccaaaaaaagaagtacttaaagcgggtttg
aaaatattacggtataccgacatgcgtgacagcctaaatgctatttctgtgccgtttttg
cgtatttatggtaagttagatgcgttagtgccctgtaagatagctgaattattggatgag
gcttggcctcacactgaatctgttatcatgcatcagtctgctcatgtgccttttatttct
catacagatgattttttagaagtgatactgtatttttatcagaaatatttttctcattag

DBGET integrated database retrieval system