KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0588Help
Entry
HDEF_0588         CDS       T00911                                 

Gene name
lpxA
Definition
(GenBank) UDP-N-acetylglucosamine acetyltransferase
  KO
K00677  UDP-N-acetylglucosamine acyltransferase [EC:2.3.1.129]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00540  Lipopolysaccharide biosynthesis
hde01100  Metabolic pathways
hde01503  Cationic antimicrobial peptide (CAMP) resistance
Module
hde_M00060  KDO2-lipid A biosynthesis, Raetz pathway, LpxL-LpxM type
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HDEF_0588 (lpxA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    HDEF_0588 (lpxA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hde01005]
    HDEF_0588 (lpxA)
Enzymes [BR:hde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.129  acyl-[acyl-carrier-protein]---UDP-N-acetylglucosamine O-acyltransferase
     HDEF_0588 (lpxA)
Lipopolysaccharide biosynthesis proteins [BR:hde01005]
 Lipid A
  HDEF_0588 (lpxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_11 Hexapep
Motif
Other DBs
NCBI-ProteinID: ACQ67330
UniProt: C4K437
Position
complement(573137..573940)
Genome map
AA seq 267 aa AA seqDB search
MIQKKTFIHPTSIVEKGAIVHEGAHIGPFCYIGSQVEIGSGTELKSHIVINGITKIGKNN
VIYQFCSIGEVNQDLKYKGEFTRVEIGDSNLIRESVSIHRGTEQGEGVTCVGNHNLLMFN
THVAHDCLIGHHCILANSTTLGGHVEIHDHAVIGGLSAVHQFCKVGSYAMLAGCSAVVKH
IPPFILAQGNHASLVGPNTVGLKRHFSEAKYKAILRAYQLLYKQGKSLEDAKLELAKLAE
LHPVVILLLNFLNQIDLNSDKNRGIVR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaaaaaaaacttttattcatccaaccagtattgttgaaaaaggtgcgattgtt
catgagggcgctcatattggtcccttctgttatattggatcacaggtagaaatcggctct
ggtacagaattaaaatctcatattgtgattaatggtataactaaaataggaaaaaacaat
gtcatttatcaattttgttctattggtgaagtgaatcaagacttaaaatataaaggtgaa
ttcacaagggttgaaattggtgactcgaatttaattcgagaaagtgtatctattcatcgg
ggcactgaacagggagagggtgtaacctgtgttggcaatcataatttattgatgtttaac
acgcatgttgcgcacgactgtctcattggtcaccactgtattttagctaatagtacaacc
ttgggggggcacgttgaaatacacgatcatgcggttattggtggcctttcggctgtgcac
caattttgcaaggtaggcagctatgcaatgttggcgggttgctctgcggttgtaaaacac
attccgccttttatactggctcaaggtaatcatgcctctcttgttggtcctaacactgta
ggactaaaacgccatttttctgaagcaaaatacaaagccatccttagagcctatcagctg
ctatataagcagggtaaaagtttagaggatgcaaaactcgaactcgctaagttagcggag
ttacatcctgtcgttatattacttttgaattttttaaatcaaatcgatcttaattctgat
aaaaaccgtggaattgttcgttaa

DBGET integrated database retrieval system