KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0589Help
Entry
HDEF_0589         CDS       T00911                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristol acyl carrier protein dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00061  Fatty acid biosynthesis
hde00780  Biotin metabolism
hde01100  Metabolic pathways
hde01212  Fatty acid metabolism
Module
hde_M00083  Fatty acid biosynthesis, elongation
hde_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HDEF_0589 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HDEF_0589 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hde01004]
    HDEF_0589 (fabZ)
Enzymes [BR:hde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     HDEF_0589 (fabZ)
Lipid biosynthesis proteins [BR:hde01004]
 Fatty acid synthase
  Component type
   HDEF_0589 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: ACQ67331
UniProt: C4K438
Position
complement(573944..574456)
Genome map
AA seq 170 aa AA seqDB search
MIISGCVVDNLSFQRRKSTLTTDTDILDIREILDLLPHRYPFLLVDRVIDLKKNKSLRAI
KNISFNEPFFQGHFPKKPIFPGVLILEAMAQATGILAFKSKGKLQSGEIYYFACIEKARF
KRPVHPGDQMILEVNFLNERLGCARFTGVAKVDEELVCEATMMCARSREV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgatcatctcgggctgtgttgttgataatctcagtttccagagaaggaagagtactttg
acaactgatactgatattttagatattagagaaattttagatttattgccgcatcgttac
ccctttttattggtagatcgtgtgatagatttaaaaaaaaataaatccttacgtgccata
aaaaatatttcttttaatgagcccttttttcaaggacattttcccaaaaaacctattttt
cctggcgtgttaatcttagaagccatggcccaagctacaggaattttagcctttaaaagc
aaaggtaaattgcaatctggtgaaatttattattttgcgtgcattgagaaggcccgcttt
aaacgtccagtgcacccaggagatcagatgatattagaagtcaattttcttaatgagagg
ctaggctgtgcccgctttactggtgttgctaaagtggatgaagagcttgtctgtgaggct
acgatgatgtgcgctcgcagtcgagaggtataa

DBGET integrated database retrieval system