KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0703Help
Entry
HDEF_0703         CDS       T00911                                 

Gene name
hemC
Definition
(GenBank) hydroxymethylbilane synthase (porphobilinogen deaminase)
  KO
K01749  hydroxymethylbilane synthase [EC:2.5.1.61]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00860  Porphyrin and chlorophyll metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HDEF_0703 (hemC)
Enzymes [BR:hde01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.61  hydroxymethylbilane synthase
     HDEF_0703 (hemC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porphobil_deam Porphobil_deamC
Motif
Other DBs
NCBI-ProteinID: ACQ67436
UniProt: C4K4E3
Position
692230..693159
Genome map
AA seq 309 aa AA seqDB search
MSNNMIRLATRQSPLALWQAHYVKTGLEFFHPDLKVILLPMVTQGDNILGTALSKTGGKG
LFVKELERAVLDNRADIAVHSIKDMPLYFPEGLGLVAVCEREDPRDAFLSLRYHDVAQLP
EGSVVGTSSLRRQCQLYKNYPGIVVRDLRGNVGARLKKLDQGDYDAIVLAVAGLKRLGLE
NRMTQILRPETSLPAAGQGAIGIECRLDDTVTLQRVATLNHRPSQLKISCERALLKRLEG
GCQTPIGSYAEIENDELWLRAFVGAPDGQLIIDGERRGNFDSAEKIGFELANELLSRGAE
AILAQLNRQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacaacatgattcgtcttgctacaagacaaagccccctggcactttggcaggcg
cactatgtgaaaacaggtttagaattttttcaccctgatttgaaggtgatattactacct
atggtcactcaaggcgataatatactcggcacagctttatcaaaaacaggaggaaaaggg
ctttttgtaaaagaattagaacgggctgttttagacaatcgtgcggatattgccgtgcat
tctataaaagatatgcctctttatttcccagagggattgggattagtcgcagtttgtgag
cgagaggatcccagagatgcgtttctttctttgcgatatcatgatgtggctcaattgcct
gaaggcagcgtagtgggaacgtccagcttaaggaggcaatgccaattatacaaaaattat
cccggtatcgttgttcgagatttacgaggtaatgtaggggctcgtttgaaaaaactggat
caaggagattacgatgccattgtgttagcagtcgcgggtttaaaacgtctcgggttggaa
aatcgcatgactcagattctcaggccagaaacatcattgccggcagcaggtcaaggtgca
atagggattgaatgccgattagacgatactgtcacacttcaacgagtggcgactttaaat
catcgaccgtctcaattgaagatctcttgtgaacgagccctactaaagcgtcttgaaggg
ggctgccagacccctattggtagctatgctgaaatagaaaatgacgagttatggctcagg
gcttttgttggtgctcctgatggccagctgatcattgatggtgaaagacgagggaatttt
gattcagcggaaaagatcgggtttgaattagcgaatgagttgttatctcgaggagcagaa
gcaattttggcacaactgaatcgacaatag

DBGET integrated database retrieval system