KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0704Help
Entry
HDEF_0704         CDS       T00911                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00860  Porphyrin and chlorophyll metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HDEF_0704 (hemD)
Enzymes [BR:hde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HDEF_0704 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACQ67437
UniProt: C4K4E4
Position
693168..693914
Genome map
AA seq 248 aa AA seqDB search
MVVLVTRPSPMGEELVQFIQAHGHTAYHYPLIEFSQGRDLMELSQRITQMREEDMIFVVS
KTAIDYLASFFKNNPLSWPPSIFYYAIGRNTAQAWQKINPFKIRYPLNQETSEGLLALAN
LQFINKKTALILRGNGGRELLGDRLKKRGAQIIYCECYQRHPVHYDGAQKSIQWQRLKVD
TVVVTSEEMLHRIYALVPEEARFAWLIKSRLIVVSARLANIATHLGWHHIQIAENASNES
LLHTVLSI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggttgttttagtcacccgaccttcaccaatgggggaagaattggttcaatttattcag
gcgcacggacatacggcctatcattatcccttaattgaattttctcaagggcgagatctg
atggagttgtctcaacggataacacagatgcgagaagaagatatgatatttgttgtgtca
aaaactgcgattgattacttagcctctttttttaaaaacaatcctctttcttggcctcca
tctattttttattatgcgattggtcgaaatacggcacaagcatggcagaagatcaacccc
tttaaaattcgatatccgttgaatcaagaaaccagcgaaggcctattggctttagcgaat
ttacaattcatcaacaaaaaaacagcactgatactcagaggaaatggaggcagagaatta
ttaggtgaccgcttgaaaaaacggggggctcagatcatttattgcgagtgttatcaacgt
catcctgttcactatgatggcgcgcaaaaaagtattcaatggcagcggttaaaagtagat
actgttgtggtgaccagcgaagaaatgttacatcgtatctatgctctggttcctgaagaa
gcgcgttttgcctggctcataaaatcccgtttaatagtggtcagtgcacgtttggcgaat
atagccactcatctgggttggcatcatattcagatagctgaaaatgcaagtaatgaatcc
ctacttcatacggtgctctcgatttaa

DBGET integrated database retrieval system