KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0705Help
Entry
HDEF_0705         CDS       T00911                                 

Gene name
hemX
Definition
(GenBank) uroporphyrinogen III methylase
  KO
K02496  uroporphyrin-III C-methyltransferase [EC:2.1.1.107]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00860  Porphyrin and chlorophyll metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HDEF_0705 (hemX)
Enzymes [BR:hde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     HDEF_0705 (hemX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HemX Jnk-SapK_ap_N DUF1664 DUF4446 Uteroglobin DcuC Elongin_A
Motif
Other DBs
NCBI-ProteinID: ACQ67438
UniProt: C4K4E5
Position
693948..695036
Genome map
AA seq 362 aa AA seqDB search
MKQEKIQITKKDNTYIEGSSASKISQKKTGRLRILLFYSLILCLSAALYYYAQKQQKESQ
SLQEEFIRLQKNQENEKKDLKSQLKKQDDALKHLALQTKQSTDKLSELEKKMANISGDPD
QIWRFFEADFWVKMAERKLWRDKDINSAIFLLKSADENLAKLNQPGLIQVRQALMSDISA
LSALHQVDIDGIIFKLNQMSDQIDHLPLSVLPERGDPMKEQPSPVSNSLSEWRKNIQKNW
DHFLSSWITVRRRDTKAEPFLSPDETIYLRENIRSHLLIAAQAAARNQNKIYHQSLGILS
TWINTYFDAKDIHNQLFLEDLKNLQQQDISIQMPEYLKSPALLKKRSHAFIQSPPFSSIE
EQ
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagaaaaaattcagataacaaaaaaagataatacctatattgaaggatcaagt
gcctctaaaatatctcaaaaaaaaacggggcggttacggatactgttgttttatagcctg
attctctgcctgagtgctgcgctttactattatgctcaaaagcagcagaaagaaagccaa
tcattacaggaagaattcatcagattacaaaaaaatcaagaaaacgaaaaaaaagatctc
aaatcacagctaaaaaaacaggatgatgctttaaaacatttggcgcttcaaacaaagcaa
tcgacagataaactttctgaattagaaaaaaaaatggccaatatttctggggatccagat
caaatttggcgtttttttgaggcagatttttgggtaaaaatggcagagcgtaaattatgg
agggacaaagacattaacagcgcgatttttttgcttaaaagtgccgatgaaaatctggcc
aagcttaatcagccgggtctcattcaagtacgccaggcactgatgtcagatatcagcgct
ttatctgctctccatcaggttgatattgatggcatcatttttaagctgaatcaaatgtcc
gatcaaatcgatcatctgcctttatctgtgctccccgaaagaggggaccctatgaaagag
caaccttcccctgtttcaaattcactttctgagtggcgaaaaaatatccaaaaaaattgg
gatcattttttatcttcatggatcactgttcgtcgccgagacactaaggcagagccattt
ttatcgccagatgaaacgatttatttaagagaaaatattcgctctcatctgctgattgcc
gcgcaagctgccgcccgaaatcaaaataaaatctatcatcagtcgcttggtattctctct
acctggataaacacctattttgacgctaaagatattcacaaccaattatttttggaagat
ttaaaaaatttgcagcaacaagacatttcaatacaaatgcccgagtacctaaaaagccct
gccttactaaaaaaaaggtctcatgcatttattcaaagccctcctttttcttctattgaa
gagcaataa

DBGET integrated database retrieval system