KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0722Help
Entry
HDEF_0722         CDS       T00911                                 

Gene name
talB
Definition
(GenBank) transaldolase B
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00030  Pentose phosphate pathway
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01230  Biosynthesis of amino acids
Module
hde_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
hde_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HDEF_0722 (talB)
Enzymes [BR:hde01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     HDEF_0722 (talB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAL_FSA
Motif
Other DBs
NCBI-ProteinID: ACQ67455
UniProt: C4K4G2
Position
join(716749..717351,719697..720050)
Genome map
AA seq 318 aa AA seqDB search
MMNKLQALRQFSTIVADTGDISAIQSYQPEDTTTNPSLILNATKIPAYRHLIDRSVAWAK
RQSSDPKQHQIDATDKLAVDIGVEILKLIPGRISTEVDACLSYDIHASIEKAQKLISLYH
EADIHKDRILIKLAATWQGIRAAEALEKLGIRCNLTLLFSFAQARACAEAGVFLISPFVG
RILDWYKKNSDTKEFLPTQDPRVLSVQKIYHYYKKHGYETVVMGASFRNTAEILELAGCD
RLTISPALLQELSEQQGTVEQKLVFRGALKEKPTPLTESEFYWQHNQDPMAVEKLSEGIR
KFAEDQEKLKNVISNLLA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatgaataaattacaagctttacgccaattcagcactattgtggcggatacgggtgat
atctcagcgatacaatcttatcaacccgaagacacgaccacgaatccttcattaatttta
aatgccacaaaaattccagcatatcgccacttgatcgatcgatccgtggcttgggctaaa
aggcaaagctcagatccaaaacaacatcagattgacgctaccgataaactcgctgtcgac
attggggtagaaattttaaaattgattcctggtcgtatttcgaccgaagtggatgcttgt
ctgtcttatgatatccacgccagtattgaaaaagctcaaaagttaatctcactttatcat
gaagccgatattcataaagatcgtatcttgattaaactggctgcgacttggcaaggcatc
cgtgctgctgaagccctggaaaaattagggattcgttgtaatctgaccctgttattttct
tttgctcaggcacgtgcttgtgcagaggcaggcgtttttctgatttcaccttttgttggt
cgtattcttgactggtataaaaagaatagtgatacgaaagagtttttacctactcaagat
cctcgtgttctttctgtacaaaaaatttatcattattataaaaaacacggttatgagacc
gtggtaatgggtgctagttttcgtaatacagctgaaattttagaattggccggttgtgac
cgcttaacgatctcacccgccttattgcaggaattatcagagcaacaaggtactgtggag
cagaagttagtgtttcggggtgccctgaaagaaaagccaacgccccttacagaatctgaa
ttttactggcaacacaatcaggatcccatggctgtcgagaaactctctgagggcatccgt
aaatttgcagaagatcaagaaaaattaaaaaatgtgatttctaacctgcttgcttaa

DBGET integrated database retrieval system