KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0766Help
Entry
HDEF_0766         CDS       T00911                                 

Gene name
eno
Definition
(GenBank) enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00010  Glycolysis / Gluconeogenesis
hde00680  Methane metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01230  Biosynthesis of amino acids
hde03018  RNA degradation
Module
hde_M00002  Glycolysis, core module involving three-carbon compounds
hde_M00394  RNA degradosome
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDEF_0766 (eno)
  09102 Energy metabolism
   00680 Methane metabolism
    HDEF_0766 (eno)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    HDEF_0766 (eno)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hde03019]
    HDEF_0766 (eno)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hde04147]
    HDEF_0766 (eno)
Enzymes [BR:hde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     HDEF_0766 (eno)
Messenger RNA biogenesis [BR:hde03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HDEF_0766 (eno)
Exosome [BR:hde04147]
 Exosomal proteins
  Proteins found in most exosomes
   HDEF_0766 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MAAL_C MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: ACQ67494
UniProt: C4K4K1
Position
756150..757451
Genome map
AA seq 433 aa AA seqDB search
MSKIAKILAREIIDSRGNPTVEVEAHLEGGFIGLAAAPSGASTGSREALELRDGNPARFL
GKGVLKAVEAVNGSIAQALLGKDAKDQQHIDQLMIDLDGTENKSHFGANAILAVSLAVAK
AGAASKGMPLYEHIAELHGTPGQFSMPLPMMNIINGGEHADNNIDIQEFMIQPVGAKSFK
EAVRMGSEVFHHLAKVLKSKNLSTAVGDEGGYAPNLESNAAALETMKEAVEKAGYVLGKD
ITFAMDCAASEFYNKETNRYELKGEGKTFTSEEFTHFLENLTQKYPIISIEDGLDESDWE
GFKYQTQVLGDKIQLVGDDLFVTNTQILKEGIQKKIANSILIKFNQIGSLTETLAAIKMA
QEAGYTAIISHRSGETEDATIADLAVGTSAGQIKTGSMSRSDRVAKYNQLIRIEEALGER
ALFNGLKEVKGQS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaattgcaaaaatactcgcccgagaaatcattgattctcgtggtaatcccaca
gtagaagtagaagcccatttagaggggggatttatcggtttggccgctgcgccatcaggg
gcctccaccggttcacgtgaagcgttagaattgcgcgatggtaaccctgcccgattttta
gggaagggcgttctgaaggcagttgaggccgtgaatggttctatcgcacaggcgctttta
ggtaaagatgcgaaagatcagcaacatattgatcaattgatgattgatttagacgggact
gaaaataaatctcattttggggctaatgccattttggccgtttctttagcggttgcaaaa
gcaggtgctgcttctaagggaatgcctttgtatgagcatattgctgagcttcatggcacg
cctggtcaattttccatgccattaccgatgatgaatatcattaacggtggtgaacacgct
gacaacaacattgatattcaagaatttatgatccagcctgtcggggcgaagagctttaaa
gaagcggttcgaatgggatctgaagtttttcatcatctggccaaagtacttaagtctaaa
aatctgagtactgcagtgggtgacgaaggcggatatgcgccaaatctcgaatccaatgca
gcggctctagaaacgatgaaagaagccgtagaaaaagcggggtatgttttaggtaaagac
atcacttttgcgatggattgtgcggcctctgaattttacaataaagaaacaaatcgttat
gaattgaaaggagaaggaaagacctttacatcagaagaatttacgcattttttggaaaat
ctgacccaaaaatatcctattatttcgattgaagatgggttagacgaatcagattgggaa
ggatttaaatatcaaactcaagtattaggcgataaaattcaattggttggagatgattta
tttgtcaccaatactcaaattctcaaagaaggcattcaaaaaaagatcgccaattcaatt
ttaattaaatttaatcaaataggctctctgactgaaacattagccgcgattaaaatggcg
caagaagcaggttacactgcgattatttctcaccgttctggtgaaacagaagacgccacc
attgctgatttagcggtgggcacctctgcaggccagattaaaacaggttctatgagtcgt
tctgatcgtgttgctaaatacaatcaattgatacggattgaagaagcattgggtgaacgt
gccctttttaacggtttaaaagaagtgaaaggccaaagctaa

DBGET integrated database retrieval system