KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0803Help
Entry
HDEF_0803         CDS       T00911                                 

Gene name
pykF
Definition
(GenBank) pyruvate kinase I (formerly F), fructose-stimulated
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00010  Glycolysis / Gluconeogenesis
hde00230  Purine metabolism
hde00620  Pyruvate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01230  Biosynthesis of amino acids
Module
hde_M00002  Glycolysis, core module involving three-carbon compounds
hde_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
hde_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDEF_0803 (pykF)
   00620 Pyruvate metabolism
    HDEF_0803 (pykF)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HDEF_0803 (pykF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hde04131]
    HDEF_0803 (pykF)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hde04147]
    HDEF_0803 (pykF)
Enzymes [BR:hde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     HDEF_0803 (pykF)
Membrane trafficking [BR:hde04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HDEF_0803 (pykF)
Exosome [BR:hde04147]
 Exosomal proteins
  Proteins found in most exosomes
   HDEF_0803 (pykF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI IMPDH
Motif
Other DBs
NCBI-ProteinID: ACQ67529
UniProt: C4K4N6
Position
complement(801073..802485)
Genome map
AA seq 470 aa AA seqDB search
MKKTKIVCTIGPSSESEEMLVQLLNAGMNVMRLNFSHGDHNEHLQRIKNLRAVIKKTNQK
AAILLDTKGPEIRTKELKGGKEVSLSIGQTFTFTTDQNIIGDAHTVAVTYPGFANDLKAG
DTVLVDDGLLAMEVIETQKNAVICKVQNNGDLGENKGVNLPGISIKLNALTEKDKEDLIF
GCQHSVDFVAASFVRKASDVLEIREFLNKNKGEGIQIISKIENEEGLNNFDEILAVSDGI
MVARGDLGVEIPVEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVAN
AIVDGTDAVMLSGESAKGKYPIESVKIMASICKRTDLVMQSRIDFLNENQEIRITEAICR
SAVETAEKLNAHLIIVATSGGKSAKSVRKYFPHAMIMALTTNEVTERQLILTKGVFPFLV
KKIDSTDDFYHIGKKKALEQKLACKGDVVIMVSGALVPSGTTNTVSVQVL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaactaaaattgtttgcactatcggtcctagcagcgaatcagaagagatgtta
gtgcagttacttaatgcaggtatgaatgtcatgcgcctgaatttttcgcatggtgaccac
aatgagcacctacaacgtatcaaaaatttgcgagccgttattaaaaagacaaatcaaaaa
gcggcgattttactggatactaaaggccctgaaattcgcacaaaggaactgaagggagga
aaagaggtttctttatctataggtcaaaccttcacgttcacgaccgatcaaaatatcatc
ggtgatgctcatactgtggcggtcacttaccctggatttgcaaatgatttaaaagccggc
gataccgtgttagtcgatgatggtttgctcgccatggaggtaatagagacccaaaaaaat
gccgtgatctgtaaggtacaaaataatggggatttaggcgaaaacaaaggagtgaattta
cccggaatttctattaaattgaatgccctaactgaaaaagataaagaagatttgatattt
ggttgtcaacattctgttgatttcgtcgccgcttcttttgttcgaaaagcgtctgatgta
ttagaaatacgcgaattcttaaataaaaataagggagaaggtattcaaatcatttctaaa
attgaaaatgaagaaggtctcaataacttcgatgaaattttggctgtttctgatggcatt
atggtcgctcgtggcgatttgggtgttgagatacctgtcgaagaagtaatttttgcacaa
aagatgatgattgaaaaatgcaatcgggctcgaaaagtggtcattacggcgactcaaatg
cttgattccatgattaaaaatcctcgtcccactcgtgctgaagcaggcgatgtcgcgaat
gcgatcgtagacggaacggatgcggtaatgctatcgggtgaaagtgccaaagggaaatat
ccgatagaatccgtaaaaattatggccagtatttgtaaacgaaccgatctggttatgcaa
agccggattgattttttgaatgaaaatcaagaaatcaggatcacagaggcgatttgtcgg
agtgctgtggaaaccgctgaaaaattaaatgctcacttgattattgtggcgaccagtggt
ggaaaatccgcaaaatcagtgcggaaatattttccacatgcgatgataatggcattaaca
acaaatgaagtgacagaaaggcagctgattttaacaaaaggggtatttccttttctggtt
aaaaaaattgattctacggatgatttttatcatatcggtaaaaaaaaggcgctagaacaa
aaattggcctgtaaaggagatgtcgtgattatggtgtcaggagcactcgtacccagtggt
acaaccaacacggtttctgttcaagtattataa

DBGET integrated database retrieval system