KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_0909Help
Entry
HDEF_0909         CDS       T00911                                 

Gene name
dcm_1
Definition
(GenBank) DNA cytosine methylase
  KO
K00558  DNA (cytosine-5)-methyltransferase 1 [EC:2.1.1.37]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00270  Cysteine and methionine metabolism
hde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HDEF_0909 (dcm_1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hde03032]
    HDEF_0909 (dcm_1)
   03036 Chromosome and associated proteins [BR:hde03036]
    HDEF_0909 (dcm_1)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:hde02048]
    HDEF_0909 (dcm_1)
Enzymes [BR:hde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     HDEF_0909 (dcm_1)
DNA replication proteins [BR:hde03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   DNA methylation enzymes
    HDEF_0909 (dcm_1)
Chromosome and associated proteins [BR:hde03036]
 Eukaryotic Type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    HDEF_0909 (dcm_1)
Prokaryotic defense system [BR:hde02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    HDEF_0909 (dcm_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_methylase
Motif
Other DBs
NCBI-ProteinID: ACQ67622
UniProt: C4K4X8
Position
complement(917408..918613)
Genome map
AA seq 401 aa AA seqDB search
MSAHIPREQDMTHAQPPERLRFIQPMPEPVLRDLLQQPAARTKKVSPRFRFIDLFAGIGG
IRMGFDAQGGECVFTSEWNRFSKKTYIQNYGAPHPFVGDIVPYPAEDVPDHDVLLAGFPC
QPFSIAGVSKKNSLGRPHGFECTTQGTLFFDVARIIATRRPWAFLLENVKNLLSHNKGHT
FNVILQTLRDELGYDVHYRVIDGQHFTPQHRERIIIVGFREKTGFSWDDLKLPEEGPRLA
SILHRTDGTEPVLPWDGERFFDHDRRAVPLRYTLTPNLWAYLQAYADKHRAAGNGFGFGI
VYPDSVTRTLSARYHKDGSEILVWQGSNKRPRRLTPRECARLMGFPDAFQIPVSDTQAYR
QFGNSVVMPVMQEVARIMTPHVRAQIAHERDGTSLALPLFS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcacacattcccagagagcaagatatgacacatgcccagccgccagaacgcctc
aggttcatacaacccatgcccgaacccgtgttgcgcgacctgttgcaacaacccgccgcc
cgcacaaaaaaagtgagcccccgcttccgcttcattgacctgttcgccggcattggcggc
atccgtatgggcttcgatgctcagggcggtgaatgcgtttttaccagcgaatggaacagg
ttctcaaaaaagacctacattcagaactacggcgcccctcatccgtttgtgggtgacatc
gttccatatccggcagaggacgtgccggaccatgatgtactgctcgccggcttcccctgc
cagccgttcagtattgcgggcgtcagcaaaaagaattcgctgggccgcccacatggtttc
gaatgcaccacgcagggaaccctgttctttgacgtggcccgtatcatcgccaccagacgc
ccttgggcgttcctgctggaaaacgtcaagaacctgctttcacacaacaagggccacacc
ttcaacgtcatcctgcaaacgctcagggacgagctgggctatgatgtgcattacagggta
atcgacgggcagcacttcacaccgcagcatcgcgaacgaatcatcatcgtcggtttccgc
gaaaaaacgggcttctcatgggatgacctgaaactaccggaagaaggtccgcgccttgcg
tcaattctgcacaggacggatggcacagagccggtgctcccctgggatggagagcgcttt
ttcgatcacgacaggcgggccgtgccgctccgatacacgttgacgcccaacctgtgggcc
taccttcaggcctatgcagacaagcaccgcgccgccggcaatgggttcggatttggtatc
gtctatcccgatagtgtgacacgcacactgtcagcccggtatcacaaggacgggtcagaa
atccttgtatggcagggcagcaacaaacggccgagacgcctgacgccacgtgaatgcgcc
cgcctgatgggcttccctgacgctttccagatacctgtcagtgatacacaggcttaccgt
cagttcggcaatagcgtcgtcatgccggtcatgcaggaagtcgcccgcatcatgacgccc
cacgtgcgggctcagatcgcgcatgaacgagacggcacctcacttgcattgcccctgttt
tcctga

DBGET integrated database retrieval system