KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1254Help
Entry
HDEF_1254         CDS       T00911                                 

Gene name
aroE
Definition
(GenBank) dehydroshikimate reductase, NAD(P)-binding
  KO
K00014  shikimate dehydrogenase [EC:1.1.1.25]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01130  Biosynthesis of antibiotics
hde01230  Biosynthesis of amino acids
Module
hde_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HDEF_1254 (aroE)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase
     HDEF_1254 (aroE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Shikimate_dh_N Shikimate_DH SDH_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ACQ67908
UniProt: C4K5R5
Position
complement(1159540..1160376)
Genome map
AA seq 278 aa AA seqDB search
MPLAKEPIVESYAVFGHPIEHSLSPQIHQSFAEQTGIHHPYCKIKVPHEDFESIVSDFFT
QGGLGANITTPFKERAYRLCDQHTEHAKCTGVVNTLKLLDKNQLLGDNTDGIGLLTDLKR
LNLLMPGDRILLIGAGGAAQGVIPSLLKEACELVITNRTLSRAQKLGRLFQHLDKIEVSE
IGALEGSSFDLIINATTSGLFGEVPDLPACLFFNNSRCYDMFYSAQASETIFIDWIKQKR
VIHYADGLGMLVAQAAYSFYLWHGVMPEITPVLSCFTV
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcctttagctaaagagccgattgtcgaaagctatgcggtttttggtcaccctattgaa
cacagcctatctccccaaattcatcaaagcttcgcagagcaaaccggcattcatcatcct
tactgcaaaataaaagtgcctcacgaagactttgaatccatcgtcagtgatttcttcacc
caaggtgggctcggtgcgaatattacaacgccttttaaagaacgagcataccggctttgt
gatcaacacacagaacacgcaaaatgcacgggagttgtgaatacattaaagcttttagat
aaaaatcaattattgggcgataacacagatgggatcggtttattaactgatttaaaaaga
ttaaatctgttgatgcctggggatcgtattttattaattggagctggaggggcagcacag
ggcgtcatcccttcattattgaaagaggcttgcgagctcgttatcaccaatcgtaccttg
agtcgcgctcaaaaattgggacggttatttcagcaccttgataaaatagaggtatcagag
ataggcgccctcgaaggcagctcttttgatttgatcatcaatgccaccacatctggtctg
tttggtgaagtacctgatttaccagcttgtctctttttcaacaacagtcgttgctacgat
atgttttattccgctcaggcatctgaaacgatttttattgattggataaaacaaaaaaga
gtgattcactatgctgatgggctgggtatgttggtggctcaagcggcgtattctttttat
ctctggcatggcgtgatgccagaaatcacaccagtgctttcttgtttcactgtttga

DBGET integrated database retrieval system