KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1256Help
Entry
HDEF_1256         CDS       T00911                                 

Gene name
pgl
Definition
(GenBank) 6-phosphogluconolactonase
  KO
K07404  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00030  Pentose phosphate pathway
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
Module
hde_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
hde_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HDEF_1256 (pgl)
Enzymes [BR:hde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     HDEF_1256 (pgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactonase
Motif
Other DBs
NCBI-ProteinID: ACQ67910
UniProt: C4K5R7
Position
complement(1161127..1162131)
Genome map
AA seq 334 aa AA seqDB search
MRQIVYVASSESHQIDVFQLNLAGQLTLIQTKKVSGQVQPMAINPNTGHLYAGVRPEFSV
VTYHIADDGQLEEVGTAALPAGPTYITTDPAGRFLFSASYSGNSVSISPIDHQGIVQKWS
EQLTNLGAPHSVNFDLTGKVLFIPCLKEDRIKLFELSVEGTLSPHYPAELITSKGAGPRH
MTFHPNNKIAYCINELKSSIDLYLIRDKGKNYTLINTVNALPEGFVGQPWAADIHMKPDG
RYLYTTDRTSHMLSIFKVSEEGIVLSLVGYQSTEAQPRGFNIDHSGQFLISAGQLSNKIA
VYRIHSLTGKLSLLSRYPVGKGPMWISILNLETS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcgacaaatcgtttatgtagcaagttctgagagccaccagattgatgtttttcaatta
aatttagctggccaattgaccctgatccaaacaaaaaaagtctcaggccaagtacaacct
atggccatcaacccgaatacaggccatttatacgcgggagtgcgacctgaattttctgtc
gtcacttatcatatcgctgatgacggtcaattagaggaagttggcactgcagctttaccg
gcggggcctacatatatcacaacagatccagccggacgttttttattttccgcttcttac
agtggaaactctgtcagtatcagcccgattgatcatcaagggattgtgcaaaaatggagt
gaacaattaaccaatttaggcgcgcctcattcagttaatttcgatctcacaggtaaagta
ttgttcattccgtgtttaaaagaagatcggataaagctttttgagttgagcgtagaaggg
acattgagcccccattatccagctgagctcatcacatcaaaaggtgccggacctcgacat
atgacatttcatcctaacaataaaattgcttactgtatcaatgaattaaaaagctcgatt
gatctgtatttgatcagggataaaggcaaaaattatactttaattaatacagtgaacgct
ttacctgaaggctttgttggtcagccttgggcggctgatattcatatgaagcctgatggg
cgttacctgtataccactgatcgtacttctcatatgctgagtatttttaaagtatcagaa
gaggggattgtactttccttagtaggctatcaatcaacagaggcacagccaagaggcttt
aatatcgatcacagtgggcagtttttaatctctgcaggacagctttcaaataaaattgct
gtttatcgtattcattcattaacaggaaaattgtcactcctttctcgttaccctgtcggc
aaaggccctatgtggatcagtattttaaatttagaaacatcctaa

DBGET integrated database retrieval system