KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1338
Entry
HDEF_1338         CDS       T00911                                 

Gene name
triG
Definition
(GenBank) TriG conjugal transfer protein
  KO
K03203  type IV secretion system protein VirB8
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:hde00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    HDEF_1338 (triG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hde02044]
    HDEF_1338 (triG)
Secretion system [BR:hde02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   HDEF_1338 (triG)
SSDB
Motif
Pfam: VirB8
Other DBs
NCBI-ProteinID: ACQ67979
UniProt: C4K5Y6
Position
1244785..1245477
AA seq 230 aa
MFTKKEAYLKTAQGFELKWRQRDKRDKTIAFIIAGVGTAFGLLSLIAMIILLPLKQTNTE
LYVADKLAGTVEKVTTVEKGELSENSALARYFTQQYVRLREGYDYFRLQHDYDTVQRYGN
EAVNKAYLDWWNSPSAPDKVFKDAEYTAEITFITHFISDSSNPDNTDLLATLRFRKDIRD
VRSGHVQPEYWTVRMTWRFEPQQAMTDAQRAHNPLGFVVTSYQREKEQGE
NT seq 693 nt   +upstreamnt  +downstreamnt
atgttcactaaaaaagaagcgtatttaaaaaccgcgcaaggatttgaattaaaatggcgg
caacgtgataaacgcgataaaaccatcgcctttattatcgcgggtgttggcaccgccttt
ggtctgctttcacttatcgccatgattattctgttgccgttaaagcagaccaataccgaa
ctttatgtcgcggataaactggcgggcacggtagaaaaagtcaccaccgtggaaaaaggg
gaattatccgaaaatagtgcgctcgcacggtattttacccagcaatatgtgcgcttgcgg
gaagggtatgattattttcgtctgcaacatgattacgacacggtacagcgctacggtaat
gaggcagttaacaaagcctaccttgattggtggaatagcccgtctgcacccgacaaggtg
tttaaggatgcagaatataccgctgaaatcacctttattacccatttcatttccgattcc
agcaatcctgataacaccgatttactggctactcttcgttttcgcaaggatatccgcgat
gtccgtagcggtcatgtgcaaccggaatactggacggtacgcatgacgtggcgattcgag
ccacagcaagccatgaccgatgcgcaacgcgcccataatccgctgggatttgtcgtcacc
agttatcagcgtgaaaaagagcagggggaatag

DBGET integrated database retrieval system