KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1490Help
Entry
HDEF_1490         CDS       T00911                                 

Gene name
mtn
Definition
(GenBank) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
  KO
K01243  adenosylhomocysteine nucleosidase [EC:3.2.2.9]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00270  Cysteine and methionine metabolism
hde01100  Metabolic pathways
hde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HDEF_1490 (mtn)
Enzymes [BR:hde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     HDEF_1490 (mtn)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: ACQ68114
UniProt: C4K6C1
Position
1366013..1366726
Genome map
AA seq 237 aa AA seqDB search
MKVGIIGAMKEEVTLLCQKIQSCQTLTRAGCSIYSGFLGETNVVLLQSGIGKTSAALGTT
LLLEYFQPDILINTGSAAGLWPDLKIGDIVISTEVRYHDVNVTAFGYEWGQMALCPPAFF
ADKKLIEIVLECVKNLNLNAVQGLICSGDAFINGDQALDRIRTFFPKAVAVEMEAAAIAQ
VCHQFETPFVVIRAISDVADQASHLSFEQFLCIAAQRSSTVIENMLPILAETYCSIN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgggtattattggtgctatgaaagaagaagtcactctgttgtgtcaaaaaatt
caatcatgtcaaactttaacacgagcaggatgctctatttactccggctttttaggggaa
acgaatgttgttttacttcaatcaggaattggaaaaacctctgctgctttgggtacaacc
ttactcctcgaatattttcagcctgatattttaattaatacaggatctgcggcaggtctt
tggcctgatttgaaaataggagatatcgtgatttctaccgaagttcgttaccacgatgtg
aatgtcactgcatttggctatgaatgggggcaaatggcgctttgccctccggcgtttttt
gcggataaaaaactcattgaaatcgtattagaatgtgtcaaaaacttaaacttaaacgca
gtgcaaggcctgatttgcagtggagatgcctttattaatggtgaccaagctctcgatcgt
attcgcacttttttcccaaaagccgtagcagtagagatggaagcggccgctattgctcaa
gtttgccatcaatttgagacgccttttgtggtcatccgtgcgatttctgatgtcgctgat
caagcgtctcatttgagctttgaacaatttttgtgcatagccgcccaacgttctagcacc
gttattgaaaatatgttacctattttggctgaaacttattgcagcattaattaa

DBGET integrated database retrieval system