KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1539Help
Entry
HDEF_1539         CDS       T00911                                 

Gene name
fbaA
Definition
(GenBank) fructose-bisphosphate aldolase, class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00010  Glycolysis / Gluconeogenesis
hde00030  Pentose phosphate pathway
hde00051  Fructose and mannose metabolism
hde00680  Methane metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDEF_1539 (fbaA)
   00030 Pentose phosphate pathway
    HDEF_1539 (fbaA)
   00051 Fructose and mannose metabolism
    HDEF_1539 (fbaA)
  09102 Energy metabolism
   00680 Methane metabolism
    HDEF_1539 (fbaA)
Enzymes [BR:hde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     HDEF_1539 (fbaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: ACQ68158
UniProt: C4K6G5
Position
complement(1411049..1412140)
Genome map
AA seq 363 aa AA seqDB search
MSTLFHVIKPGVVTGDDVQKIFSIAKKHQFALPAVNCVGTDSINAVLEAASKAKAPVIIQ
FSHGGAAFIAGKGITSSETQGSAILGAISGAYHVHQMAEHYGIPVILHTDHCAKKLLPWL
DGLLDAGEKHFDKTGIPLFSSHMIDLSEESLKDNIDTCSQYLKRMEKLGMTLEIELGCTG
GEEDGVDNSHLDNSSLYTQPEDVAYAYEKLHQISPRFTIAAAFGNVHGVYKPGNVQLTPT
ILRDSQQYVSKKFSLPPNSLNFVFHGGSGSSAKEIKEALGYGVIKMNIDTDTQWATWEGV
LQYYKKNELYLQHQLGNPEGADRPNKKYYDPRVWLRSAQLSMIERLKQAFADLNAVDSLS
STS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacactatttcatgtgataaaacccggcgttgtgacgggagatgacgtacaaaaa
atcttttctatcgcaaaaaaacatcaatttgcgctgcctgcggtgaactgtgtggggaca
gattccatcaacgccgtattagaagcggcatccaaagccaaagcccctgtcattattcaa
ttttctcatggtggagccgcgtttattgcaggtaaaggcattacttcgtcagaaactcaa
gggtcagcgatactgggtgcaatttctggcgcttatcatgtccaccaaatggcagaacat
tacggtattccagttattttgcacacagatcattgtgcaaaaaaattgcttccatggtta
gatggcttattagatgctggagaaaaacattttgacaaaacaggcatacctttattttca
tcccatatgatcgatctgtcggaagaatctttaaaagacaatatcgatacttgcagccaa
tatctcaagcgtatggagaaattaggaatgactctagagattgaattgggttgtactggt
ggtgaagaagacggcgttgataatagccatcttgataattcatcgctctacactcagcca
gaagacgtggcttatgcttatgaaaaattgcatcagatcagccctcgtttcacaattgcc
gccgcatttggtaatgtccacggagtctataaacccggtaatgttcaactgacgccgaca
atattgcgcgattctcaacagtatgtttccaaaaaatttagtttgcctcctaacagctta
aattttgtatttcatgggggatcaggttcgagcgctaaagaaattaaagaagcgcttggt
tacggcgtaatcaaaatgaatatcgacacagacacgcaatgggcgacctgggagggggtg
ttacagtattataaaaaaaatgagctttatttgcagcatcagctcggcaaccctgaaggg
gctgatcggccaaataaaaagtattatgatcccagagtatggctgcgctcagctcagctc
agtatgatagaacgtctaaagcaagcatttgcagatcttaatgcggttgactccctgtca
tcaacatcataa

DBGET integrated database retrieval system