KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1540Help
Entry
HDEF_1540         CDS       T00911                                 

Gene name
pgk
Definition
(GenBank) phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00010  Glycolysis / Gluconeogenesis
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01230  Biosynthesis of amino acids
Module
hde_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDEF_1540 (pgk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hde04147]
    HDEF_1540 (pgk)
Enzymes [BR:hde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     HDEF_1540 (pgk)
Exosome [BR:hde04147]
 Exosomal proteins
  Proteins found in most exosomes
   HDEF_1540 (pgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK
Motif
Other DBs
NCBI-ProteinID: ACQ68159
UniProt: C4K6G6
Position
complement(1412203..1413393)
Genome map
AA seq 396 aa AA seqDB search
MSDVDLAGQRLLIRSDLNVPLKNGEVISDARIRASLPTITAALKQGAKVMVASHLGRPTE
GQYDAAFSLLPVVNYLKNHLYSECPFPIRFVKDYLHGIDVVPGELVVLENVRFNKGELKN
DVQLSQQYAALCDVYVMDAFGTAHRAQASTEGVGQYAPISCAGPLLSNELQALNQALSHP
ARPMVAVVGGSKVSTKLTALEALSKVADQLIVGGGISNTFLAALGHNIGQSLHEADLIPE
AKKLLETCDIPIPTDVRVATEFSETAQATLKPVDQVNSDEKILDIGDVSATHLVRILKNA
KTILWNGPVGVFEFPNFRKGTETLARAIADSEAFSIAGGGDTLAAIDLFSIADRISYIST
GGGAFLEFVEGKALPAVAMLEKRYQVDMNAYNKKES
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgtagatttggcgggtcagcgccttctaattcgctctgacctcaatgttccg
cttaaaaacggagaagtgatttctgatgcgcggatccgtgcatcattgcccacgattaca
gcggcacttaaacaaggagcaaaagtcatggtggcctcgcatttaggtcgcccaactgaa
gggcaatacgacgccgctttttctttattgcctgtcgtcaattacctcaaaaaccacctc
tattctgaatgcccctttcccatccgttttgttaaagactatcttcatggtatcgatgta
gtgcctggtgaattagtggttctcgaaaatgtgcgatttaacaagggggaattaaaaaac
gatgttcagctctctcaacagtatgctgctctgtgtgatgtctatgtgatggatgccttt
ggtaccgcgcatcgtgcacaggcctcgaccgaaggtgtcggtcaatacgcccctatttca
tgcgcgggccccttattatcgaacgaactacaggcattaaatcaagcgttaagtcatccg
gcacgacctatggtcgccgttgtaggcggctctaaggtgtcaaccaaactgaccgctttg
gaagccttatctaaagtggccgatcaattgattgttggagggggtatttccaatactttt
ttggccgcacttggccataatatcggtcaatcgcttcacgaagcagatttgattcctgaa
gccaaaaaactcctggaaacctgtgatattcctatccctaccgatgtccgtgtggccact
gaattttctgaaaccgctcaggccactctaaagcccgttgatcaagtcaattccgatgaa
aaaattttggatattggtgatgtttctgcgacacatttagtgaggattttaaaaaacgca
aaaaccattttatggaatggtccagtgggcgtgtttgaatttcctaattttcgcaaaggt
actgaaacattggcacgagcgattgctgacagcgaggctttttctatcgctggaggtggg
gatacactcgcggcaatcgatctcttttctattgctgatcgcatttcttatatctctaca
ggaggcggggcttttttagaatttgttgaaggcaaagcattgcccgcagtagcgatgtta
gaaaagcgttatcaggtagacatgaatgcttacaataaaaaagaatcataa

DBGET integrated database retrieval system