KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1632Help
Entry
HDEF_1632         CDS       T00911                                 

Gene name
ubiC
Definition
(GenBank) chorismate pyruvate lyase
  KO
K03181  chorismate--pyruvate lyase [EC:4.1.3.40]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00130  Ubiquinone and other terpenoid-quinone biosynthesis
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
Module
hde_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    HDEF_1632 (ubiC)
Enzymes [BR:hde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.40  chorismate lyase
     HDEF_1632 (ubiC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chor_lyase UTRA
Motif
Other DBs
NCBI-ProteinID: ACQ68244
UniProt: C4K6Q1
Position
complement(1486551..1487078)
Genome map
AA seq 175 aa AA seqDB search
MSTKKKSIIKCIDWRSIEEPDLPLEVAGWLMEAGSMTERFERHCHKIIIDLKHEGFIEHQ
ALSDEKELLPESPRYWIREVVMCADDEPWLLGRTVIPQDTLSGPEHALLNLGKTPLGRYL
FSSKDLKRDYIQTGRQGDLWARRSLLQLSNKPLLLTEVFLPASPLYCHSRNTKLA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgaaaaaaaaatccattatcaaatgtattgattggcgctctattgaagagcct
gatttgccattggaagtggcgggatggctgatggaagcaggctctatgactgagcgcttt
gagcgacattgtcacaagataatcatcgatctcaaacacgaaggctttattgaacatcag
gctttatctgatgaaaaagagctgctccctgagagcccacgttattggatacgagaggtc
gtgatgtgtgctgatgatgaaccctggctacttggccgtaccgttatcccacaggatacc
ctgtcagggcctgaacatgcgctgttgaatctcggcaaaacacctcttgggcgctatttg
tttagtagtaaggatctgaaacgagattacattcaaacgggacgtcaaggtgatctctgg
gcaaggcgatccttattacagttatccaataaaccgctattattaacagaagtttttttg
cctgcttcccctctgtattgccattccaggaacaccaagcttgcataa

DBGET integrated database retrieval system