KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1637Help
Entry
HDEF_1637         CDS       T00911                                 

Gene name
rpe
Definition
(GenBank) D-ribulose-5-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00030  Pentose phosphate pathway
hde00040  Pentose and glucuronate interconversions
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01230  Biosynthesis of amino acids
Module
hde_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
hde_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HDEF_1637 (rpe)
   00040 Pentose and glucuronate interconversions
    HDEF_1637 (rpe)
Enzymes [BR:hde01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     HDEF_1637 (rpe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribul_P_3_epim QRPTase_C PGM_PMM_II His_biosynth TMP-TENI
Motif
Other DBs
NCBI-ProteinID: ACQ68249
UniProt: C4K6Q6
Position
complement(1490200..1490877)
Genome map
AA seq 225 aa AA seqDB search
MKKYLIAPSILSANFARLGEDTANVLRAGADFIHFDVMDNHYVPNLTMGPMVCQALRDHG
IEAPIDVHLMVKPVDALVSRFAQAGASYISFHPEASEHIDRTLQLIKQQGCQAGLAFNPA
TSLHYLDYVLDKLDLILLMSVNPGFGGQAFIPSTFKKLSQVRKIIDDSGYDIRLEVDGGI
KVDNIAEVAHCGADIFVAGSAIFSQPDYHVVIHAMRNELLKVKIN
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatttaattgcgccttctattttatctgcaaattttgcccgcttaggcgaa
gatactgccaacgtcctcagagcaggtgccgattttatccattttgatgtgatggataac
cactatgtgcctaatctgacgatgggcccgatggtgtgtcaagccttgcgggatcatgga
attgaagcgcccatcgatgtgcatctcatggtaaaacccgtggacgccctggttagccgt
ttcgctcaagctggggcgagctatatttcgtttcatcctgaagcttcagaacatattgat
cgaactttacagctgattaaacaacagggatgccaggctggtttagcgtttaatcctgcc
acttctctccattatctcgattatgttctggataagttagatctgattttattgatgtct
gtcaatcctggtttcggagggcaagcctttattcccagcacgtttaaaaaattaagccaa
gtccgaaaaatcattgacgacagtggctatgacattcgtttagaggttgatggtggtatt
aaggttgataatattgctgaagtagcacattgcggagcggatatatttgtagccggttct
gctattttcagccaacctgattaccatgtggtcattcatgccatgcgaaatgaattactt
aaagttaaaattaattag

DBGET integrated database retrieval system