KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1640Help
Entry
HDEF_1640         CDS       T00911                                 

Gene name
aroB
Definition
(GenBank) dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01130  Biosynthesis of antibiotics
hde01230  Biosynthesis of amino acids
Module
hde_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HDEF_1640 (aroB)
Enzymes [BR:hde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     HDEF_1640 (aroB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: ACQ68252
UniProt: C4K6Q9
Position
complement(1491838..1492926)
Genome map
AA seq 362 aa AA seqDB search
MKKMTITLGPRNYPITISSGLLNHFDSFEPLKKGDQGMLVTNQTLAPLYLSSIRTVLEQG
GVRLDHIILPDGEKYKSLASIELIFTELLKKWHGRHTTLIAFGGGVIGDLTGFAAACYQR
GIRYIQIPTTLLAQVDASIGGKTAVNHQLGKNMIGAFYQPASVIIDIDCLSHLPLRHFSS
GLAEAIKYGIAFDFDFFCWLEANMDSLLRRDVDALSHCISRCCQIKSKIVMEDERDENGL
RALLNLGHTYAHAIETETNYIFYLHGEAVSIGMLMAAQTAQKLGLFSKTDIIRIKKLLLR
AKLPIQGFHQIDPKSCLLHMMHDKKVMNDKLRLIIPTAIGQSEIYEGIDNDIVLASIKET
LM
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatgacgattactttaggtccgcgcaattatcctattaccatttcttcagga
ttattgaatcattttgattcttttgagccgctcaaaaaaggggaccaaggcatgttggtg
acgaatcaaaccttagcgcctctttatctttcttcaattcgaacggttttagagcaaggc
ggcgtcaggctcgatcatatcattttacccgatggtgaaaaatataagtcattggcgtct
attgaactgatatttactgaacttttaaaaaaatggcatgggcgtcacaccactttgatt
gccttcggagggggcgtcataggagatttaacaggttttgcggcagcctgttatcaaaga
ggcatccgatatattcaaatccccactactttgttggcgcaagtagatgcttcgataggc
ggaaaaacggccgttaaccatcaacttggaaaaaacatgattggcgctttttatcaacct
gcttctgtcattattgatattgactgtttatctcatttgcctctgcgtcactttagttca
gggttagctgaagccatcaaatatggtattgcttttgattttgattttttttgttggtta
gaagccaatatggattctttattaagaagagatgttgatgctttaagtcattgtattagt
cgttgttgtcaaataaagtccaaaatagtgatggaggatgaacgtgatgaaaatggctta
agagccttacttaatttaggtcatacctatgctcatgccattgaaacagaaacgaattat
attttttatctacatggtgaagcggtttctatcggtatgttgatggccgctcaaaccgct
caaaaattagggctattttccaagaccgatatcatacgaataaaaaaattattattacgg
gcaaagctgcccattcaaggatttcatcagattgatccaaaatcctgtttattgcatatg
atgcatgataaaaaagtcatgaatgacaaattacgattaattatcccaaccgctataggt
cagtcagaaatatatgagggaatcgacaatgatattgttctcgcttctattaaagagacg
ttaatgtga

DBGET integrated database retrieval system