KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1641Help
Entry
HDEF_1641         CDS       T00911                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01130  Biosynthesis of antibiotics
hde01230  Biosynthesis of amino acids
Module
hde_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HDEF_1641 (aroK)
Enzymes [BR:hde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     HDEF_1641 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 Cytidylate_kin AAA_18 dNK Cytidylate_kin2 AAA AAA_16 TsaE AAA_24 ABC_tran AAA_22 AAA_PrkA AAA_5 AAA_7 RNA_helicase Ploopntkinase3 APS_kinase AAA_17 AAA_29 RsgA_GTPase Mg_chelatase IstB_IS21 AAA_28
Motif
Other DBs
NCBI-ProteinID: ACQ68253
UniProt: C4K6R0
Position
complement(1492960..1493481)
Genome map
AA seq 173 aa AA seqDB search
MIEKRNIFLVGPMGAGKSTIGRQLAQQLSMEFFDSDKEIERCTGADISWIFDLEGEQGFR
YREEILINQLTEKKGIVLATGGGSIKSKETRNVLSARGVVIYLETSIEKQLIRTQRDKKR
PLLQSVGQCPQFFQTLAKERNPLYEEIADIIIPTEDHSFKIVAKKIIHLLEKP
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgatagagaaacgaaatatttttctggtcgggcctatgggtgccggcaaaagtactatt
ggccgacaactagcccaacagctcagtatggagttttttgactctgataaagaaattgag
cgatgtacaggcgctgatatcagctggatattcgatctcgaaggggaacaaggctttcgg
tatcgtgaagaaatattaattaatcaactcactgaaaaaaaaggcattgtgttggcgaca
gggggaggttcaattaaatctaaagaaacccgaaacgttttatcagcccgtggggtggtc
atttatttagaaaccagcattgaaaagcaattgatccggactcagcgtgataaaaagcgc
cctctattacaatcagtaggtcagtgtcctcagttttttcaaacactggcaaaagaacga
aatcctctttatgaagaaatcgcggacatcattatcccaacagaagatcacagcttcaaa
atcgttgcaaaaaaaattattcacctattagaaaaaccctaa

DBGET integrated database retrieval system