KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1746Help
Entry
HDEF_1746         CDS       T00911                                 

Gene name
nadA
Definition
(GenBank) quinolinate synthetase, A protein
  KO
K03517  quinolinate synthase [EC:2.5.1.72]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00760  Nicotinate and nicotinamide metabolism
hde01100  Metabolic pathways
Module
hde_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    HDEF_1746 (nadA)
Enzymes [BR:hde01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.72  quinolinate synthase
     HDEF_1746 (nadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NadA
Motif
Other DBs
NCBI-ProteinID: ACQ68347
UniProt: C4K704
Position
complement(1589113..1590174)
Genome map
AA seq 353 aa AA seqDB search
MLDLNSIDYPFPTAPVSLSQNETVFYREKIKGLLKKRNAVLVAHYYTSPDIQSLAEETGG
CVADSLEMARFGCHHPASTLLVAGVRFMGETAKILSPEKTVLMPTLKAECSLDLGCPADA
FSAFCDDYSDRTVVVYANTSAAVKARADWVVTSSIAVELIEHLDDLGEKIIWAPDKHLGH
YVQKKTGADILCWQGACIVHDEFKTQALVQMKALYPDAAVLVHPESPQTVVELADAVGST
SQLIQSAKSLPHQTLIVATDRGIFYKMQKMCPDKTLLAAPTAGEGATCKSCAHCPWMAMN
GLQAMAEALEAQSSPHEIFVEKGLIEKALIPLNRMLDFANSLKSSFKSTSERI
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgttagatctaaattcaattgattatccgttccctactgctcccgtttcattgagccag
aatgaaaccgtattttatcgtgaaaaaatcaaaggattgttaaaaaaaaggaatgcggta
ttggtcgcgcactattacaccagcccagatattcaatctttggcagaagaaacagggggt
tgtgtcgccgactcattagaaatggcgcgttttggttgtcatcaccctgcatcgacttta
ttggttgccggcgttcgttttatgggggaaacggctaaaattttgagcccagaaaaaacg
gtattgatgccgacgctaaaagcagaatgctctttggatttaggttgccctgccgatgca
tttagcgctttttgtgatgattattctgatcgtaccgtggtggtctacgccaacacctcg
gccgccgtcaaagcaagagcagattgggtcgtcacctcaagtattgcggtggaattgata
gaacatctggacgatttaggggaaaaaatcatttgggcgccagataaacatttaggacat
tatgttcaaaaaaaaacgggggcagatatcctttgctggcaaggggcttgtattgttcat
gatgaatttaaaacacaggccttagttcaaatgaaggcgctttatcctgacgcggcggta
ttagtgcacccagaatctcctcaaacggtggtcgagttggcagatgccgtgggatcaacc
agccagctgattcaatcggccaaaagcttacctcatcaaactttgatcgttgcgacagac
cgagggattttttataaaatgcagaaaatgtgccctgataaaacgctattggccgcccct
acagccggtgaaggcgcaacatgtaaaagttgtgctcattgcccttggatggcgatgaat
ggtttacaagccatggccgaggcactagaagcacagagcagccctcatgaaatttttgtt
gaaaagggattgattgaaaaagcattgattcctttaaatcgcatgttagattttgccaat
tcattaaaatcctctttcaaaagcacctcagaaaggatttga

DBGET integrated database retrieval system