KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1806Help
Entry
HDEF_1806         CDS       T00911                                 

Gene name
sfcA
Definition
(GenBank) NAD-linked malate dehydrogenase
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00620  Pyruvate metabolism
hde01200  Carbon metabolism
hde02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HDEF_1806 (sfcA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HDEF_1806 (sfcA)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     HDEF_1806 (sfcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-ProteinID: ACQ68401
UniProt: C4K758
Position
complement(1647660..1649348)
Genome map
AA seq 562 aa AA seqDB search
MKFEYENKRPLYIPYAGPVLLEFPLLNKGSAFTEEERSQFNLHGLLPETVETIQEQTERA
YQQYQEFTNDIDKHIYLRNIQDTNETLFYRLLCRHLPEMMPIIYTPTVGEACQHFLNIYR
RGRGLFISYPHRADMDGILQNAVRQNVKVIVVTDGERILGLGDQGIGGMGIPIGKLALYT
ACGGISPAYTLPIVLDVGTNNSQRLKDPLYMGWRHERISGNEYYAFVDQFINAVKRRWPN
VLLQFEDFAQKSATGLLNRYRDQLCCFNDDIQGTSAVTLATLIAASGGQLKEKTIAFLGA
GSAGCGIAEQIIIQMQSEGLTEKAARERIFMVDRFGLLTDRLPNLLNFQKKLTQKIGCLQ
SWNLDKKAISLLDVIRNARPDILIGVSGQPGLFTQELIHEMCLYSAHPIILPLSNPTSQV
EALPEEIIHWSQGSALIATGSPFKPVYYKDQIYSIGQCNNAYIFPGIGLGVLASGACRIT
DAMFMAASRALASQSPLLLTGKGGLLPNIDDIHKVSKSIAFEVGKTAQLENKAPLISEEA
LMQSIERNYWKPEYRRYKRTAL
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaatatgaaaataaacgccctctatatattccgtacgctggtccagttttg
ttggaatttccattactgaataagggtagtgcctttacagaagaagaacgtagccaattt
aatctccatggtttattgccagaaaccgtagagactattcaagagcagactgaacgggct
taccaacaatatcaggaatttacgaatgatatagataagcatatttatttaagaaatatc
caggatactaacgagacattattttatcgtttactctgtcgccacctccctgaaatgatg
cccattatttatactccgactgtgggcgaggcctgtcagcattttttaaatatttatcgg
cgagggcggggcctatttatttcttaccctcatcgcgctgatatggatgggattcttcag
aacgccgtgagacaaaatgtgaaggtcatcgtggttacggatggtgaacgtattttgggt
ttgggtgatcaaggaattggcggtatgggcatcccgattgggaaactcgcattatatact
gcctgtggagggataagccctgcttacaccttaccgattgttctggatgtcggcacaaac
aattctcaaagattaaaggatcctctttatatgggttggcgtcatgagcgtatttctggt
aatgaatattatgcttttgtggatcaatttattaacgctgtgaaacgtcgttggcctaac
gtacttttacaatttgaggatttcgctcaaaaaagtgccacaggtttattaaaccgttat
cgtgatcaactttgctgctttaatgatgacattcagggtacctctgcagtcacgcttgcc
actttaattgcagcaagtggaggccaattaaaagagaaaaccattgcttttttgggcgca
ggctcagctggttgtggtattgcagagcaaattattatacagatgcaatcagaaggttta
acggaaaaggcggccagagagcgaatatttatggtagatcgctttggtttgctgacagat
agattacccaatttgttaaattttcaaaaaaaattgacacaaaaaatcgggtgccttcaa
agttggaatttagataaaaaggccatttctttactagatgtgatccgaaatgctcgccca
gatattttaattggtgtttcaggtcaacctggattattcactcaagagctgattcatgaa
atgtgcctttattccgctcatcctattatcctgcctctttctaacccgacttctcaggtg
gaggccttgccggaagaaattattcactggagtcaggggagtgctctgatagcaacgggc
agtccatttaaacctgtttattataaagaccagatttactcgattggacaatgtaataat
gcatatatttttccaggcattggattaggcgtattagcatcaggcgcttgtcgaattaca
gacgcgatgtttatggctgcaagccgcgctttggcttctcagtcgcctttattgctgaca
ggaaagggggggttacttccgaacattgatgatattcataaagtatcaaaaagtattgct
ttcgaggtaggaaaaacagctcaattagaaaataaagcgccgttaatttctgaagaggct
ttaatgcagtctattgaacgtaattattggaagccagagtatcgtcgttataaacgaact
gccttataa

DBGET integrated database retrieval system