KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1807Help
Entry
HDEF_1807         CDS       T00911                                 

Gene name
metG
Definition
(GenBank) methionine tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00450  Selenocompound metabolism
hde00970  Aminoacyl-tRNA biosynthesis
hde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    HDEF_1807 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HDEF_1807 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hde01007]
    HDEF_1807 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hde03016]
    HDEF_1807 (metG)
Enzymes [BR:hde01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     HDEF_1807 (metG)
Amino acid related enzymes [BR:hde01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HDEF_1807 (metG)
Transfer RNA biogenesis [BR:hde03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HDEF_1807 (metG)
 Prokaryotic type
   Other AARSs
    HDEF_1807 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ACQ68402
UniProt: C4K759
Position
complement(1649375..1651012)
Genome map
AA seq 545 aa AA seqDB search
MTESIKKILVTCALPYANGPIHLGHMLEHIQADIWVRYQRMRGHEVYFICADDAHGTAIM
LKAEKSGINPEKMIEEINQQHQNDFSGFLISYDHYYSTHSDENRELSVAIYQRLKAKGHI
KKRAISQLYDPEKKLFLPDRFVKGTCPKCQAPNQYGDNCEACGSTYSSTELIAPKSEVSG
ATPVIRESEHFFFDLPAFTGMLTQWIHSGALQEQVANKMQTWLTSGLRQWDITRDTPYFG
FEIPDAPDKYFYVWLDAPIGYMGSFKNFCDKKENVSFDEFWQTDTKTELYHFIGKDIVYF
HSLFWPAVLEGSDFRKPTNLFVHGYITVNGAKMSKSRGTFIEASDYLKHLDPDCLRYYYA
AKLSSHIDDIDLNLEDFVQRVNADLVNKVVNLAARNASFINKKFAGILSKELADSELYFT
FVQAGLRIANAYHARETSKAIREIMALADLANRYVDEQAPWVLAKKEVDEAKLQSVCSMG
IHLFRILMTYLKPVLPALSERSEAFLNTELTWDSINEPLLNHEIKPFKALFNRIDNDKIV
AMLKC
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatctatcaaaaaaatattggtcacctgtgcattgccctatgccaatggtccc
attcacttagggcatatgttagaacatattcaagcggatatttgggtgcgttatcaacga
atgagaggccatgaggtttattttatttgtgcagatgacgctcatggtactgccattatg
ctcaaagcagaaaaatcaggcatcaatccagagaaaatgatcgaagaaataaatcagcag
catcaaaatgatttttctggatttctaatcagttatgatcattattactctactcacagt
gatgaaaatcgtgagctttccgtggccatttatcaacgtctcaaagcgaaaggacacatt
aaaaaacgggctatctcacaattatatgatcctgaaaaaaagctttttttgcctgatcgt
tttgtaaaaggcacctgccctaaatgccaagctcccaatcaatatggggacaattgtgaa
gcttgtggttctacttacagttccactgaattgattgctcctaaatcagaggtttctggc
gcaacgcctgtaatacgtgagtctgaacatttcttttttgatttgccggcattcactgga
atgctaacacaatggattcattctggcgcactgcaggaacaggtggccaataaaatgcag
acttggctcacatctggtcttcgtcaatgggacatcacacgtgataccccttattttgga
tttgaaatccctgatgcgcccgataaatatttttatgtttggttggatgccccgattggt
tatatgggatctttcaaaaatttttgtgataaaaaagaaaatgtcagttttgatgaattt
tggcagacggatactaaaactgagctgtatcattttattggcaaagacattgtgtatttt
cacagtttattttggcctgctgtactagaaggaagtgattttcgtaaaccaaccaatcta
tttgtacatggatacatcacggtcaatggcgcaaagatgtctaaatctcgtggtactttt
attgaagcaagtgattatttaaagcatttagatcctgattgtttgcgttactattatgca
gccaaattatcttctcatatcgatgacatcgatttaaatcttgaagattttgtgcagcgt
gtgaatgctgacctggtcaataaagtggtgaacctggcagcacgaaatgccagttttatc
aataaaaaatttgcaggtattttatcgaaagaattagcagattcagagttatatttcact
tttgttcaagcaggcctacgcatagcaaatgcctaccatgctcgtgaaacgagtaaagcg
attcgtgagatcatggcactggcagatttagccaatcgatatgtagatgaacaagcccct
tgggtacttgcaaaaaaagaagttgatgaagcaaaacttcagtctgtttgctcaatggga
atccatttattccgtatattaatgacctatcttaaacctgttctgcctgctttgtcagag
agaagcgaagcattcctgaataccgaattgacttgggactcaatcaatgagcctttattg
aatcatgaaattaagccttttaaagctctttttaaccgtatagacaacgataaaatagtc
gcgatgctgaaatgttga

DBGET integrated database retrieval system