KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1820Help
Entry
HDEF_1820         CDS       T00911                                 

Gene name
fruB
Definition
(GenBank) PTS family enzyme IIA (N-terminal); FPr (C-terminal), fructose-specific
  KO
K02768  PTS system, fructose-specific IIA component [EC:2.7.1.202]
K11183  phosphocarrier protein FPr
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00051  Fructose and mannose metabolism
hde01100  Metabolic pathways
hde01120  Microbial metabolism in diverse environments
hde02060  Phosphotransferase system (PTS)
Module
hde_M00273  PTS system, fructose-specific II component
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HDEF_1820 (fruB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    HDEF_1820 (fruB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hde02000]
    HDEF_1820 (fruB)
Enzymes [BR:hde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     HDEF_1820 (fruB)
Transporters [BR:hde02000]
 Phosphotransferase System (PTS)
  Enzyme I and HPr
   Phosphocarrier protein HPr [TC:8.A.8 4.A.2]
    HDEF_1820 (fruB)
  Enzyme II [TC:4.A]
   Fructose-specific II component [MD:M00273]
    HDEF_1820 (fruB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_2 PTS-HPr TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: ACQ68415
UniProt: C4K772
Position
1666234..1667367
Genome map
AA seq 377 aa AA seqDB search
MFQLSIENIHLDCHASNKIEAIKQVAKALAQAGEVDESYVKDMIQREEQISTYLGNGIAI
PHGTTESRALIKKTGIQVFQFPKGIEWDVDHIAYIVIGIAAHSDEHLSLLRQLTYVLNDN
AVAKKLAQTKSATELRSLLIGETKNPDLFFDISLIALDVPTENMTTLKALNAGRLKEISS
VDEHFVSEVILQSPVHLGEGIWLSDTPKGNLLSAIAISRPLTPFKHDDQEVSLLLTVSAA
DDKPKRILAYLGQLLLTKKAGLLLKADASTLLSLLTSDYIDSTQTVSAEFVIQNKHGLHT
RPATLLVNLIKQFNSEINVANLNGTGKKVNACSLMKVVGLGCKQGHRLQFTAQGEDASTA
LKEIGKAITSGLGETLA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgttccagttgtcaatagaaaacattcatttggattgccatgcttcaaacaaaattgaa
gcaataaaacaagtggcaaaagcattagcacaagcaggagaagttgacgagagttatgtc
aaagatatgatccaacgcgaagaacaaatttcaacctatcttggcaatggaatcgctatc
ccacatggcacaactgaaagccgtgctttaataaaaaaaacagggatacaagtatttcaa
ttccccaaaggaattgagtgggatgtcgatcacattgcttatattgtgattgggattgct
gctcattctgatgagcatctgtctttactaagacaactaacttacgtactaaatgacaat
gcagtcgctaaaaaattagctcaaaccaagtcagcaacagaattaagatcgctattaata
ggagaaacaaaaaatcctgatcttttctttgatatttcgctgattgctttagatgtgccc
acagaaaatatgaccacactaaaagcattaaatgcgggtcgtttaaaagaaatctcctca
gtggatgaacactttgtcagtgaagtgattcttcaatcgcccgtccatcttggagaaggt
atttggttaagtgataccccaaaaggtaaccttctcagtgctatcgcgataagccgtcca
ttaactccttttaaacatgatgatcaggaggtgagcttgctgctgactgtatctgcagcc
gacgacaaacccaaaaggattttagcttacctgggccaattattgttaacaaaaaaagcc
ggcttattgttaaaagcggatgccagcactttgctatctttattgacaagcgattatata
gactctactcaaacggtcagtgcagagtttgtgatccaaaataaacatgggttacataca
cgccctgccaccttgctggtgaatctgatcaaacaatttaacagtgagatcaacgttgct
aatctaaatggcacaggtaaaaaagtgaatgcctgcagcttaatgaaagtggtcggatta
gggtgtaagcaaggtcatcgcttacagtttactgctcagggtgaagatgcttctacggca
ttaaaggaaataggcaaggcgattacgtctggtttaggggagacgttggcttga

KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1822Help
Entry
HDEF_1822         CDS       T00911                                 

Gene name
fruA
Definition
(GenBank) PTS family enzyme IIB'BC, fructose-specific
  KO
K02769  PTS system, fructose-specific IIB component [EC:2.7.1.202]
K02770  PTS system, fructose-specific IIC component
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00051  Fructose and mannose metabolism
hde01100  Metabolic pathways
hde01120  Microbial metabolism in diverse environments
hde02060  Phosphotransferase system (PTS)
Module
hde_M00273  PTS system, fructose-specific II component
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HDEF_1822 (fruA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    HDEF_1822 (fruA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hde02000]
    HDEF_1822 (fruA)
Enzymes [BR:hde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     HDEF_1822 (fruA)
Transporters [BR:hde02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component [MD:M00273]
    HDEF_1822 (fruA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_IIB
Motif
Other DBs
NCBI-ProteinID: ACQ68417
UniProt: C4K774
Position
1668311..1669993
Genome map
AA seq 560 aa AA seqDB search
MKTLLIIDSHYGPASQYLAEWMLKTSADKLQLHFVEKPDDAELIIAVGAVRDEFGVFENK
KLFTGSLESALNDPDVFLKQALSEAKMYQASEKTPDLSHQTKRIVAITACPTGVAHTFMA
AEAIESEAHKRNFWVKVETRGSVGAANTLTAEDIEAADLVIVAADIEVNLDKFQGKRLYR
TSTSSALKKTAQEFDHALATSEIYHSPSQHAKPSHSRTDQGQGIYGHLLTGVSYMLPMVV
AGGLCIALSFIFGIKAFETPGTLAAALMQIGGASAFALMVPVLAGFIAFSIADRPGLTPG
LIGGMLAVSTGAGFLGGIIAGFLAGYVSKIISTKLYLPSSMNALKPILIIPLISSLIVGL
IMIYLIGEPVAQIMAALTSWLEAIETANAVLLGAILGGMMCSDMGGPVNKAAYSFGVALL
SSSVYAPMAAIMSAGMVPPLAMGLATFLARHKFETSEREAGKAALVLGLCFVSEGAIPFA
ARDPMRVLPCCIAGGALTGALSMMFGAKLMAPHGGLFVLMIPGAIHPAILYLVAILAGTV
LTGILYAILKSPNAPLVPES
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattattaatcatagacagccattacgggccagccagccaatatctggctgaa
tggatgttaaaaaccagcgcagataaattacaattgcattttgtagaaaagccagacgat
gcagagttgattattgccgttggtgcagttagagacgaatttggtgtatttgaaaataaa
aaattatttacaggctcattagaatcagcactaaatgatcctgacgtttttttaaaacag
gctctatctgaagcaaaaatgtatcaagcctctgaaaaaacccccgacctttctcaccaa
acaaaacgtattgttgcaatcacagcctgtcctactggtgttgctcatacctttatggct
gcagaagcgattgaatcagaagcccacaaacgaaatttttgggtcaaagtggaaacaaga
ggttcggtcggtgccgctaatactctcacggccgaagacattgaagccgctgatttggtt
atcgttgctgcagatatcgaagtcaatctggataaatttcaaggaaagcggttgtaccgt
acttccacatcttcagcattaaaaaaaaccgctcaagagttcgatcatgctttagccaca
tcagagatttatcattctccttcccagcacgcaaaaccatctcacagccggacagatcaa
ggtcagggtatatatggtcatttgctgaccggagtgtcttatatgcttcccatggtggtt
gctggtgggttgtgtatcgcgctttcttttatatttggcatcaaagcatttgaaacgcca
gggacacttgccgccgccttaatgcaaatcgggggcgcttctgcttttgctttgatggtg
cccgtgttagccggttttattgctttttctattgctgatcgtcccggtttaacaccggga
ctgattgggggcatgttggcggtcagtacaggcgctggatttttagggggcatcattgcc
ggttttcttgcaggttatgtctcaaaaatcatcagcacgaaattatatctcccttctagc
atgaacgcgttaaaacctattcttatcatcccattaataagcagccttattgttggtctt
atcatgatctatctgatcggcgaacctgttgctcaaatcatggcagcgctgacaagctgg
ttagaagccatagaaacggctaatgcggttctgctaggtgcgattttgggaggaatgatg
tgttcagacatgggaggaccggtgaataaagcggcttattcttttggggttgctctctta
agttcctcggtttatgcgccgatggcggcgattatgtccgcagggatggtgcccccactg
gcgatggggttagcgacatttctggctaggcataaatttgaaaccagcgaacgagaggca
gggaaagccgctttggtgttgggtttgtgttttgtttctgaaggtgcgattccctttgca
gccagagatccgatgagagtattgccctgctgtatcgccggaggcgctttaacaggggcg
ctctcgatgatgtttggcgcaaaattaatggcaccccatggtggattatttgttttaatg
atcccaggtgcgattcatcctgcgatcctttatttagtggctattttggccggcacagta
ttgactggaatactttatgctattttaaaatcgccgaatgcgcctctggttccagagtct
taa

DBGET integrated database retrieval system