KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1823Help
Entry
HDEF_1823         CDS       T00911                                 

Gene name
aspC_2
Definition
(GenBank) aspartate aminotransferase, PLP-dependent - 2
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00220  Arginine biosynthesis
hde00250  Alanine, aspartate and glutamate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01130  Biosynthesis of antibiotics
hde01210  2-Oxocarboxylic acid metabolism
hde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HDEF_1823 (aspC_2)
   00290 Valine, leucine and isoleucine biosynthesis
    HDEF_1823 (aspC_2)
   00220 Arginine biosynthesis
    HDEF_1823 (aspC_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hde01007]
    HDEF_1823 (aspC_2)
Enzymes [BR:hde01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     HDEF_1823 (aspC_2)
    2.6.1.66  valine---pyruvate transaminase
     HDEF_1823 (aspC_2)
Amino acid related enzymes [BR:hde01007]
 Aminotransferase (transaminase)
  Class I
   HDEF_1823 (aspC_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACQ68418
UniProt: C4K775
Position
1670073..1671335
Genome map
AA seq 420 aa AA seqDB search
MPSTEKDKEPSTFSEKRSNIKKSHKLDEVCYDIRGPVLKEAKRLEEEGHHVLKLHIGNPA
PFGFNAPEEILVDVIRNLPAAQGYCDSKGLYSARKAIMQHYQARNMHHLTVEDIYIGNGV
SELIVQSMQALLNTGDEMLIPAPDYPLWTAAVSLSNGKAIHYLCDEGADWFPDLCDIRRK
ITSSTKGIVIINPNNPTGSVYSKALLSEIVEIARQHNFIIFADEIYDKILYDGAQHHSIA
ALAPDLFTVTFNGLSKTYRVAGFRQGWMVLHGPKKHAKDYIEGLEMLASMRLCANVPMQH
AIQTAIGGYQSINELIKPKGRLYEQREMAWHLINEIPGLSCTKPAGALYMFPKFDTKRFH
LYDDQKMVLDLLLQEKVLLVHGRAFHWPEPDHVRIVILPAVNELAQGIKKLKRFLSSYRQ
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgccttctacagaaaaagataaagaaccttcaacgttttcagaaaagcgctctaatatt
aaaaaatctcataaattagatgaggtttgttacgatattcgtggccctgtcttaaaagaa
gcgaaacgtcttgaagaagaagggcatcatgttttaaagctccacatcggcaacccagcg
ccttttggtttcaatgcgcccgaagaaattctggtcgatgtgattcgtaatttgccggcg
gctcaaggttactgtgattcgaaagggctgtattccgctcgtaaagccatcatgcaacat
tatcaagcccgaaacatgcaccatctcacagtagaagacatctacattgggaatggcgtt
tcagagctgattgttcaatcgatgcaggcgttattaaatactggggatgaaatgttgatc
cctgcaccagattatcccttgtggacggcagcggtttctctttcaaatggaaaagcgatt
cattatctctgtgatgaaggcgctgactggtttccagatctgtgcgatattcgtcgtaaa
attacgtcttctacgaaagggattgtcattattaatcccaataatccaacaggatcagta
tatagcaaagctttattatcagagattgtagagatcgcccgtcagcataattttatcatt
tttgcagatgaaatttatgacaaaattctttacgatggcgcgcagcatcattccattgcg
gctttagcgcctgatttgtttacagtgacgtttaacggattatcgaaaacctacagagtg
gcaggatttcgacaaggttggatggtattacatgggcctaaaaaacacgcaaaggactat
attgaaggtttggagatgttggcctcgatgcgtttgtgtgccaatgtgccgatgcaacat
gcgattcagacggccatagggggctatcaaagcattaacgaattgattaagcccaagggc
cgtttgtacgaacaaagagaaatggcgtggcatctgatcaatgaaattcctggattatct
tgtactaaacccgctggcgcactttatatgttccccaaattcgatacaaaacggtttcat
ttgtacgatgaccaaaaaatggtgttagatcttcttttacaagagaaagtcttattagtg
catggaagggcttttcattggcctgagcccgatcatgtgcgtatcgttattttgcccgcc
gttaatgaattggctcagggtattaaaaaactaaaacgatttttgtcttcttatcgtcaa
taa

DBGET integrated database retrieval system