KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1839Help
Entry
HDEF_1839         CDS       T00911                                 

Gene name
dapA
Definition
(GenBank) dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00261  Monobactam biosynthesis
hde00300  Lysine biosynthesis
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    HDEF_1839 (dapA)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    HDEF_1839 (dapA)
Enzymes [BR:hde01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     HDEF_1839 (dapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS TrmE_N
Motif
Other DBs
NCBI-ProteinID: ACQ68434
UniProt: C4K791
Position
complement(1690594..1691493)
Genome map
AA seq 299 aa AA seqDB search
MLTKTDVFSGCIVALVTPMDNKGRLDEISLKKLVDHHVERKTQAIVSVGTTGESATLNHD
EHVYVVLKTLEFASGRIPVIAGTGANSTDEAISLTQHFHNTAVAACLTVTPYYNRPTQEG
LYQHFKAIAESTELPQILYNVPSRTGCDLLPPTVARLSKIKHIIGIKEATGDLNRVREIQ
SLICDEKFILLSGDDATGLDFMELGGKGIISVTANVATAKMNDLCALAQEGFFSQARILN
QKLLPLHHHLFIEPNPIPVKWACYKLQLITTDTLRLPMTRLVESAKPKVMAALKSAGLL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgttaactaaaacagatgttttcagcggatgtattgtggcattggttactcctatggac
aacaaaggccgtttggatgaaatcagtctaaaaaaattagtggatcatcatgttgagaga
aaaactcaagcgattgtttccgttggtacaacgggcgaatctgcaactttaaatcatgat
gaacacgtgtatgttgtattaaaaaccttggaatttgcatcaggtcgaatccctgtcatt
gctggtacaggggctaattcgacagacgaagccatttctttgacacaacatttccataat
acagctgtcgctgcttgtttaacggtgactccctattacaatcggcccacccaagaaggg
ttataccagcattttaaagcgattgcagaaagcactgagctcccacagattctttataat
gtcccctcacgtactggttgtgacctcctgcctccaacggttgcacggctatctaaaatt
aagcatattattggtattaaagaagccactggtgatttaaatcgtgtcagagagatccaa
tctttgatttgtgatgaaaaatttattcttctaagcggtgacgatgcaactggtttagac
tttatggaactgggtgggaaaggtattatttcagtgacagcgaatgtcgcaactgccaaa
atgaatgacctctgtgcgttggctcaagagggatttttttctcaagctcgaattttaaac
caaaagctgttgcccttacaccatcatttatttattgagccaaaccctattccagttaaa
tgggcttgttacaagttacagttaatcacgactgatactctacgcttacctatgactcgt
ttagttgaatcggccaaacctaaagtaatggcggcattaaaaagtgctggtttactttaa

DBGET integrated database retrieval system