KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1861Help
Entry
HDEF_1861         CDS       T00911                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal subunit protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hde00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HDEF_1861 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hde03011]
    HDEF_1861 (rplV)
Ribosome [BR:hde03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HDEF_1861 (rplV)
  Bacteria
    HDEF_1861 (rplV)
  Archaea
    HDEF_1861 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ACQ68456
UniProt: C4K7B3
Position
complement(1701969..1702319)
Genome map
AA seq 116 aa AA seqDB search
METIAKHCHARSSAQKVRLVVDLIRGKQVPRALEILSYTNKKAAVLVKKVLESAVANAEN
NDGADIDELKITRIFVDEGPTMKRTMPRAKGRADRILKRTSHITVVVSDGRDSGDE
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatcgctaaacattgccacgcccgctcttctgctcaaaaagtacgcctcgta
gtggatttgattcgcggtaagcaagtgccgagagctctggaaattttaagttacactaat
aaaaaagccgcggttttagttaaaaaagtattagaatctgctgttgctaatgcagaaaac
aacgatggtgctgacattgatgaactgaaaattacgcgaattttcgtagatgaaggccct
accatgaaacgtacaatgccacgtgccaaaggccgtgcagatcgtatattgaagcgcacc
agccacattactgttgttgtgtctgatggcagagactctggagacgagtaa

DBGET integrated database retrieval system