KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1873Help
Entry
HDEF_1873         CDS       T00911                                 

Gene name
cysK
Definition
(GenBank) subunit of cysteine synthase A and O-acetylserine sulfhydrolase A, PLP-dependent enzyme
  KO
K01697  cystathionine beta-synthase [EC:4.2.1.22]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00260  Glycine, serine and threonine metabolism
hde00270  Cysteine and methionine metabolism
hde01100  Metabolic pathways
hde01130  Biosynthesis of antibiotics
hde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HDEF_1873 (cysK)
   00270 Cysteine and methionine metabolism
    HDEF_1873 (cysK)
Enzymes [BR:hde01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.22  cystathionine beta-synthase
     HDEF_1873 (cysK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACQ68466
UniProt: C4K7C3
Position
complement(1709743..1710438)
Genome map
AA seq 231 aa AA seqDB search
MELNYVTGNYKENEVAVVERQHLAAALAKEIPGAVFMNQSDNVANAGGYGDFVREIVQQV
GKVDAYVGCVGTGGSMTGISHGLKVHNPNTTIIAVEPVGSIVFGKPGHPYYQSGTGTPDG
DTVGLVFDYSTIDMGEQVSDAQAFETARYIAKKYGLLVGGSTGGVIYKALELIYQNQISG
NIVIAVADGGEKYLNTVFNEEWLEERDLLDQTIWQQLDEWFFKTEVLKDAL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggagctcaattatgtaaccgggaactataaagaaaatgaagtcgccgtggtggagaga
caacatcttgccgccgctttagcaaaagaaatcccaggcgctgtttttatgaatcaatca
gacaacgttgccaatgcaggggggtatggtgattttgtcagagaaatagtgcagcaagtt
ggaaaagtggatgcttatgtgggttgtgtaggaacaggtggttcgatgacggggatttct
catggtttaaaggtccataatcccaatacaacgatcattgcggttgagcctgtaggttct
attgttttcggaaaaccaggacatccttattatcaatcaggtacgggcacaccagacgga
gataccgtaggtttggtctttgattatagtacgattgatatgggtgaacaggtttccgac
gctcaagcgtttgaaaccgcccgttacatagctaaaaaatatggccttttggtaggcggt
tcaacagggggagtgatctataaagcattggagctgatttatcaaaatcaaatttcgggc
aatattgtgatcgcggtggccgatggtggagaaaaatatctcaacactgtttttaatgaa
gaatggttagaagaacgagatcttcttgatcaaacgatatggcaacaacttgacgaatgg
ttttttaaaacagaagtattaaaggatgctttgtga

DBGET integrated database retrieval system