KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1874Help
Entry
HDEF_1874         CDS       T00911                                 

Definition
(GenBank) putative lysine/ornithine decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00300  Lysine biosynthesis
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    HDEF_1874
Enzymes [BR:hde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     HDEF_1874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orn_Arg_deC_N Ala_racemase_N AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ACQ68467
UniProt: C4K7C4
Position
complement(1710407..1711216)
Genome map
AA seq 269 aa AA seqDB search
MSNTTPEKLTAYVKKYGSPLNLIWPENLHNNLTALRKALQQLHRHLIFYAVKVNKSQALP
ESAAKSGIGADVSSLYEMRAARKSGIPYSKICASGPSKTSIFLTDLITHDACISIDSTEE
FEEIKALIAHIQPAHQVRVLLRYRPSFLPISRFGMKSEDLSLCLDKLASLKKQCHFLGFH
FHLSGYDCKTRIEAIRELHPMITRAQSLGIKAQIMNIGGGLPVQYVDQHKSQAYLKEHSP
ADYDHKKPPLSFYPYGGELNGAQLCNREL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacacaaccccagagaaattaaccgcctacgtcaaaaaatatggttctcccctc
aacctcatttggccagaaaatctacacaataatctcacggctctacgtaaagcattgcag
caattacatcgacatttgattttttatgcggtgaaagtcaataaatcacaggctttgccg
gaatccgccgcaaaaagtggcattggcgctgatgtgtctagtctttatgagatgcgcgcg
gcgcgaaaatcggggatcccttattcaaaaatttgtgccagtggcccttctaaaacttcg
atatttctcaccgatctcatcacccatgatgcgtgtatttcgattgattcaaccgaagaa
ttcgaagaaataaaagcgttaattgctcatattcagcctgcacatcaggttcgtgtgttg
ctgcgctatcgtccgagttttttgccaatcagccgttttggaatgaaaagtgaagatctt
tcgttatgtttagacaaactcgcatctctaaaaaaacaatgccattttttaggttttcat
tttcatctcagtggttatgactgtaaaacacggattgaggccattcgtgagttgcatccc
atgataacaagggctcagtcgcttggtattaaagcgcagatcatgaatattggcggaggc
ttaccagtacagtacgttgatcaacacaaatctcaggcgtacttaaaggagcacagtccg
gcagattatgatcataaaaaaccgccgctttcattttatccctatggaggagaattgaat
ggagctcaattatgtaaccgggaactataa

DBGET integrated database retrieval system