KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1882Help
Entry
HDEF_1882         CDS       T00911                                 

Gene name
gltA
Definition
(GenBank) citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00020  Citrate cycle (TCA cycle)
hde00630  Glyoxylate and dicarboxylate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01210  2-Oxocarboxylic acid metabolism
hde01230  Biosynthesis of amino acids
Module
hde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hde_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDEF_1882 (gltA)
   00630 Glyoxylate and dicarboxylate metabolism
    HDEF_1882 (gltA)
Enzymes [BR:hde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     HDEF_1882 (gltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_synt
Motif
Other DBs
NCBI-ProteinID: ACQ68473
UniProt: C4K7D0
Position
complement(1717046..1718329)
Genome map
AA seq 427 aa AA seqDB search
MSDKKATLIIDGETLIELDRFSPTLGTQVIDVRPLISKKYFTFDPGFTSTASCESKITFI
DGEKGVLLHRGFPIKELANHSTYLEVCYILLYGEPPTPEQYATFKTTITRHTMIDDQITH
LFRGFRRDSHPMAVLCGVTGALAAFYHNGLDVHDQNHRELSAFRLLSKMPTMAAMCYKYS
IGQPFVFPRNNLSYAANFLNMMFSTPCEEYQVTPVLERAMDRILILHADHEQNASTSTVR
TAGSSGSNPFACIAAGIASLWGPSHGGANEACLKMLEEIGKAENIPKFIARAKDKNDDFR
LMGFGHRVYKNYDPRAKVMKEACDEVLNELNIQDPLFEVARELEHIALNDHYFIEKKLYP
NVDFYSGLILKAIGIPTSMFTVIFTVARTIGWISHWKEMHDEGLKIARPRQLYRGYTQRA
FKSQNFH
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataaaaaagcaacgctcattattgatggagaaactttgattgaacttgaccga
ttttcacctactttagggacccaggtcatcgatgtgcgccctttgatttctaaaaagtat
tttacttttgatccaggatttacttcaacggcttcatgtgaatcaaaaattacatttatc
gacggtgaaaaaggtgtgttattacatcgtggtttccctattaaagaactcgcgaatcat
tccacttatttagaagtgtgttacatcttattgtatggtgagcctcctaccccagaacaa
tatgcgacattcaaaacaaccatcacccgccatacgatgatcgatgatcaaatcacacat
ttatttcgtggctttcggcgtgattcacatccaatggcggtactttgtggtgtcacaggt
gctctggcggctttttaccataatggtttagatgtgcatgatcaaaatcatcgcgaactc
agtgcgtttcgtttattgtccaagatgccgaccatggcggccatgtgctacaaatattct
atcggtcagccttttgtttttcctcgaaataatctctcttacgccgctaattttttaaat
atgatgttttcaaccccttgtgaagaataccaggttacccctgttttggagcgtgcgatg
gatcgcattttaattttgcatgcagatcatgagcaaaatgcatccacgtccacagtacgt
acagcgggttcttctggctccaatccttttgcttgtattgccgctgggatcgcgtcttta
tggggcccttctcatggaggagccaatgaagcctgcttaaaaatgctagaggaaataggt
aaagctgaaaatattcctaaatttatagcgcgggctaaagataaaaatgatgattttcga
ttgatgggatttggtcatagagtgtacaaaaattatgatcccagagcaaaagtgatgaaa
gaagcctgtgatgaagtgttaaatgagctcaatatacaagatcctttgttcgaagtagca
agggaattagagcacattgcgctcaacgatcattactttattgagaaaaaactctatcct
aatgtcgatttttattccgggcttatcctgaaagcaataggtattccgacttcgatgttt
actgtgatatttactgtggccagaacgattggctggatttcacactggaaagaaatgcat
gatgaaggacttaaaattgctcgaccccgtcagctgtatcggggatacactcagcgtgca
tttaagagccaaaattttcattaa

DBGET integrated database retrieval system