KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1883Help
Entry
HDEF_1883         CDS       T00911                                 

Gene name
sdhC
Definition
(GenBank) succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with SdhD
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00020  Citrate cycle (TCA cycle)
hde00190  Oxidative phosphorylation
hde00650  Butanoate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
Module
hde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hde_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDEF_1883 (sdhC)
   00650 Butanoate metabolism
    HDEF_1883 (sdhC)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HDEF_1883 (sdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ACQ68474
UniProt: C4K7D1
Position
1718710..1719090
Genome map
AA seq 126 aa AA seqDB search
MTKKQRPINLDLMTFRFPLTAIASILHRISGVIIFFAVGCFVWLLGLSLSSPEGFIKAST
IIDYFLIKLILWGFLTALFYHLLGGIRHLLMDFGCIEENLKLGIRSAQVVMVITVLLSIL
VGIIIW
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaaacaaagaccgatcaatttagatttaatgacgtttcggtttcctctaacg
gcaattgcttcgattttgcatcgtatatcaggcgtgattattttttttgctgtcggttgc
tttgtttggcttttaggtctttctctttcttcaccagaaggctttataaaagcctctacc
ataatcgattattttttgatcaaattgatactgtggggttttctcacagccttgttttat
catcttttagggggcattcgtcatttgttaatggattttggttgtattgaagaaaaccta
aaactgggtatccgctctgctcaggtggtgatggttatcacagttttactgtcgatttta
gtgggaatcatcatatggtaa

KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1884Help
Entry
HDEF_1884         CDS       T00911                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with SdhC
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00020  Citrate cycle (TCA cycle)
hde00190  Oxidative phosphorylation
hde00650  Butanoate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
Module
hde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hde_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDEF_1884 (sdhD)
   00650 Butanoate metabolism
    HDEF_1884 (sdhD)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HDEF_1884 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ACQ68475
UniProt: C4K7D2
Position
1719084..1719431
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGIQDWLLLRASAIIIALYVFYLFGFFAITPNVTYEIWQHFFAAAFTKIF
TLLTLFSILIHAWIGLWQVFTDYVKSLPLRLLLQLLVLVVLMVYVFYGTMVVWSV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcttctgctttagggcgtaatggaattcaagattggctactactgcgt
gcctctgcgattattattgcgctatatgttttttatctttttggtttttttgcgattacc
ccgaatgtaacttacgaaatttggcaacatttttttgccgctgctttcactaaaattttt
acccttctcactttattctcgattctgattcatgcctggattggcctatggcaagtattc
accgattatgtcaaatcattacctttgagactgttactacaactgctggtgttggtcgta
ttgatggtctatgtattttacggaacgatggtcgtttggagtgtttaa

KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1885Help
Entry
HDEF_1885         CDS       T00911                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, catalytic and NAD/flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00020  Citrate cycle (TCA cycle)
hde00190  Oxidative phosphorylation
hde00650  Butanoate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
Module
hde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hde_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDEF_1885 (sdhA)
   00650 Butanoate metabolism
    HDEF_1885 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HDEF_1885 (sdhA)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     HDEF_1885 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     HDEF_1885 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like FAD_binding_3 Thi4 FAD_oxidored DAO Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ACQ68476
UniProt: C4K7D3
Position
1719432..1721198
Genome map
AA seq 588 aa AA seqDB search
MKLPVRAFDAVVIGAGGAGMRAALQISQMGLSCALVSKVFPTRSHTVSAQGGITVALGNH
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCQNGPEAIIELEHMGLPFSRQDDGRIYQRPFG
GQSLNFGGAQAARTAAAADRTGHALLHTLYQQNLKNNTTIFSEWYALDLVKNQDGVFVGC
TAISIETGEIVYFKARATILATGGAGRIYQSTTNAHINTGDGIGMALRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNRHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCEGPWGPHVKLKLDHLGKEVLESRLPGILELSRTFAHVDPIKEPIPVIPTCHYMMGGI
PTKFTGQAITVNPNGEDEVIPGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRAVGLHLS
ESLKEQGESRDASDADLDAALERIHRWNNTQSGEDPVEIRQALQTCMQNHFSVFREGESM
AEGLKKLNVIRERLNHARLEDNSTEFNTQRIECLELDNLMETAFSTAVSAHFRTESRGAH
SRFDFTERDDINWLCHSLFLPQTQSMARRKVNMEPKLRPAFPPKVRSY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgcctgtaagagcatttgatgctgtcgtcattggtgctgggggtgccggcatg
cgcgcggccctgcaaatttctcagatggggctctcctgcgcgctggtttcaaaagtgttc
ccgacccgctctcataccgtatctgcccaaggggggatcaccgtcgcattaggcaatcat
catgaagacaactgggaatggcacatgtatgacaccgtcaaaggctcggattatattggc
gatcaggatgcaatcgaatatatgtgtcaaaacggccctgaagccatcattgaattagaa
cacatggggttacccttttctcggcaggatgatgggcgtatttatcagcgccctttcggc
gggcaatctctgaattttggcggcgctcaagccgctcgcacggcggcggcggccgatcga
accggacatgctttgctgcataccctctaccaacaaaatttaaaaaacaacaccacgatt
ttttctgaatggtatgcattggatctggtcaaaaaccaggatggcgtttttgttggatgc
accgccatctccattgaaacgggcgaaatcgtttattttaaagcgcgtgccaccattctt
gcgacggggggggcagggcgaatttatcaatcgacaacgaatgcgcatattaatacgggc
gatggtattggtatggcgttgcgtgctggggtccccgtgcaagatatggaaatgtggcaa
tttcatccaacaggcattgcaggggctggcgttttagtgactgagggttgtcggggcgaa
ggcggatatttactaaaccgtcatggcgaacgttttatggaacgctatgcgcctaacgca
aaagatctcgcggggcgtgacgtggtcgcacgttctatcatgattgaaattcgtgaaggc
aggggctgtgaagggccttgggggccacacgtcaaattaaaattagatcatttaggcaaa
gaagtgctcgaatcacgtttacccggtatcctggaattatctcggaccttcgctcatgtc
gaccctatcaaagagcctattcctgttatcccaacctgccattatatgatgggcgggatc
cctactaaattcacaggccaggccatcactgtcaatccaaatggggaagatgaagtgata
cccggcttatttgctgtaggtgaagttgcctgtgtttctgtgcatggcgccaaccgttta
gggggtaattctttacttgatttggtggtgtttggtcgagcggttgggcttcatttatca
gaatccttaaaagagcaaggcgaaagtcgtgatgccagtgatgctgaccttgacgctgct
ctagaacgcattcatcgttggaataacacacaatcaggcgaagatcccgttgaaattcgt
caagcattgcaaacctgcatgcaaaatcatttttctgttttccgtgaaggtgaatcgatg
gctgagggattaaaaaagctcaacgtcatccgagagagactcaaccatgcacgcctggaa
gataattcgactgaatttaacacccagcgtattgaatgcctggaattggataatttgatg
gaaaccgctttttcaacggccgtttctgcccatttccgtacagaaagtcgaggtgcccat
agccggtttgatttcacagaacgtgatgacatcaactggttatgtcactcattattttta
ccacagacacaaagtatggcgcgtcgtaaagtaaatatggagcccaaactcagacccgca
tttccacctaaagtgcgttcttactga

KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1886Help
Entry
HDEF_1886         CDS       T00911                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, Fe-S protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00020  Citrate cycle (TCA cycle)
hde00190  Oxidative phosphorylation
hde00650  Butanoate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
Module
hde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hde_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDEF_1886 (sdhB)
   00650 Butanoate metabolism
    HDEF_1886 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HDEF_1886 (sdhB)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     HDEF_1886 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     HDEF_1886 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: ACQ68477
UniProt: C4K7D4
Position
1721264..1721980
Genome map
AA seq 238 aa AA seqDB search
MTLEFSIYRYNPDVDDKPRMQDYSLPFEEGRDMMLLDALIALKEKDPTLTFRRSCREGVC
GSDGMNMNGKNGLACITPLSSLIKANQKMVIRPLPGLPVVRDLVVDMAQFYAQYEKIKPY
LLNDGKNPPAREHLQSPEERAKLDGLYECILCACCSTACPSFWWNPDKFVGPAGLLAAYR
FLIDSRDTQTQTRLEGLDDAFSVFRCHGIMNCVSVCPKGLNPTRAIGHIKSMLLERGA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgaattttcaatctatcgttataatcctgatgtcgatgataagccacgaatg
caagattatagtctgccattcgaagaaggcagggatatgatgttgctcgatgccctcatt
gcgttaaaagaaaaagatcccaccctgacttttcgccgatcctgtcgtgaaggtgtttgt
ggttcagatggcatgaacatgaatggcaaaaatgggctggcttgtattacaccgttgtca
agcctgattaaagccaatcaaaaaatggtcattcgccctctccctggtctgcctgtggtg
cgtgatctcgtggtggatatggcccaattttatgcccagtacgaaaaaatcaagccttac
ctattaaatgacgggaaaaacccgcctgcccgagaacatttacaatctcctgaagaaaga
gccaaattagacgggttatatgaatgtattttatgtgcttgttgttccactgcttgccct
tcattttggtggaaccccgataaatttgtgggccccgcagggttattagccgcatatcgt
tttttaatcgacagcagggatacacaaacgcaaactcgtttagagggtttagatgatgca
ttcagtgtttttcgttgtcatggcattatgaattgtgtcagtgtttgccctaaaggcctc
aacccaacacgcgccatcgggcacatcaaatccatgttattagaacgtggtgcttaa

DBGET integrated database retrieval system