KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1884Help
Entry
HDEF_1884         CDS       T00911                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with SdhC
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00020  Citrate cycle (TCA cycle)
hde00190  Oxidative phosphorylation
hde00650  Butanoate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
Module
hde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hde_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hde00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDEF_1884 (sdhD)
   00650 Butanoate metabolism
    HDEF_1884 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    HDEF_1884 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ACQ68475
UniProt: C4K7D2
Position
1719084..1719431
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGIQDWLLLRASAIIIALYVFYLFGFFAITPNVTYEIWQHFFAAAFTKIF
TLLTLFSILIHAWIGLWQVFTDYVKSLPLRLLLQLLVLVVLMVYVFYGTMVVWSV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcttctgctttagggcgtaatggaattcaagattggctactactgcgt
gcctctgcgattattattgcgctatatgttttttatctttttggtttttttgcgattacc
ccgaatgtaacttacgaaatttggcaacatttttttgccgctgctttcactaaaattttt
acccttctcactttattctcgattctgattcatgcctggattggcctatggcaagtattc
accgattatgtcaaatcattacctttgagactgttactacaactgctggtgttggtcgta
ttgatggtctatgtattttacggaacgatggtcgtttggagtgtttaa

DBGET integrated database retrieval system