KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1887Help
Entry
HDEF_1887         CDS       T00911                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate decarboxylase, component of the 2-oxoglutarate dehydrogenase complex, thiamin-binding
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00020  Citrate cycle (TCA cycle)
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
Module
hde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDEF_1887 (sucA)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     HDEF_1887 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: ACQ68478
UniProt: C4K7D5
Position
1722017..1724824
Genome map
AA seq 935 aa AA seqDB search
MQNGLMQAWLNSSYLAGANQSYIEQLYEDFLINPNSVEQSWKTIFEQFSSAETARPLHSE
VRQYCRDLAKNKAGLLSSCNGLDFDSKQVKVFNLMNAFRFQGHQNAHLDPLGLWEREPVP
DLNLAYHDLTESDFENSFNIGSFAIPKKTMTLADLYTALKKTYCGSIGAEYMHINNTEER
LWIQQRIEPIMGQPQFDPEEKRRFLSELTAAEGLERYLGAKFPGAKRFSLEGGDALVILL
KELIRHAGQQGMKEVVLGMAHRGRLNVLINVLGKMPQDLFDEFAGKHKEHLGTGDVKYHQ
GFSSDIETEGGLIHLALAFNPSHLEIVSPVVIGSVRARRDRLSDKASNKVFPVTIHGDAA
ITGQGVVQETLNMSRARGYEVGGTVRIVINNQIGFTTSNPQDARSTEYCTDVAKMVQAPI
FHVNADDPEAVAFVARLALDFRNTFKRDFMIDLVCYRRHGHNEADEPSATQPIMYQKIKK
HPTTREIYAQKLIQENIVTQEDATEMVNLYRDALDQGKGVVKEWRPMKPHSFNWQPYLNH
EWDAQYPPNTVKMASLTELAKKISRIPEKIDMQSRVAKIYADRAEMAAGKKPLDWGAAET
LAYATLLDKGISIRLSGEDSGRGTFFHRNAVIYDQKNGSTYVPLENIHQHQGDFKVWDSV
LSEEAVLAFEYGYSTAEPRTLTIWEAQFGDFANGAQVVIDQFISSGEQKWGRMCGLVMLL
PHGYEGQGPEHSSARLERYLQLCAEQNIQVCIPSTPAQVYHMLRRQSLRPMRRPLVVMSP
KSLLRHPLAISSLKELAEGTFLPAIGEMDDLNSDSIKRVVICAGKVYYDLLEQRRKNQQD
NVAIIRIEQLYPFPHQAIKMLFEPYAHVHDFVWCQEEPLNQGAWYCSQHHFREVIPFAAS
LRYAGRPASASPSVGYLSVHQKQQKDLLNDALTME
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacgggctaatgcaggcttggttgaattcttcctatctggcaggagctaatcaa
tcctatatagaacaactctacgaagattttttaatcaatcccaattcagtagaacaaagc
tggaaaaccatttttgagcaattttcatccgccgaaacggccagaccattacattcagaa
gttcgtcaatattgtcgagatttagcaaaaaacaaggcgggtttattatcttcctgtaac
ggcttagatttcgattccaagcaagtcaaagtattcaatctgatgaatgcttttcgcttc
cagggccatcaaaacgcgcatttagatcctctcggtttatgggagcgcgaacccgttcct
gatcttaatctagcctatcatgatttaactgaaagtgattttgaaaacagtttcaacatc
ggttcctttgctattccaaaaaaaacaatgacattggcagatttatacactgcattaaag
aagacgtattgcggctcgataggcgccgagtatatgcatatcaacaatactgaagaaagg
ctctggatacagcaacgcatcgaacctatcatggggcagcctcaatttgatcctgaggaa
aaacggcgttttttaagtgaattgacggctgccgagggcttagagcgttatttaggggcc
aaatttccgggagcgaaacgcttttcactcgagggcggcgatgctttggttatcttgctg
aaagaactgattcgtcacgcaggtcagcagggcatgaaagaagtcgttctgggtatggcg
caccgtggtcgtttgaatgtgttgatcaatgtattaggcaaaatgcctcaagatcttttt
gatgaatttgcaggcaaacataaagagcatctcggcacaggggatgtcaaatatcatcaa
ggtttttcctctgatattgaaacagaagggggcctgattcatttggcgttggcgtttaat
ccgtctcatttggaaattgtcagccccgttgtcatcggctctgtacgagcgcgtcgtgat
cgcctcagtgataaagcaagcaataaagtattccccgtcacgatccacggggatgcagca
atcactgggcaaggcgtggtgcaagaaaccttaaatatgtctcgagcccgaggttatgaa
gtgggcggaacagtgcgcatcgtgattaacaatcaaatcggttttaccacctcaaatccc
caagatgcccgctccaccgaatattgcactgatgtcgccaaaatggtacaggcaccgatt
tttcacgtcaatgcggatgacccggaagccgtggcttttgtcgctcgtttggccctggat
tttcgtaacacttttaagcgcgattttatgatcgatttggtgtgctaccgacgacatggc
cacaatgaagcggatgaaccgagcgcgactcaacccatcatgtaccaaaaaatcaaaaaa
catccaacaactcgggaaatctacgcacaaaaattaattcaggaaaatatcgtcactcaa
gaagacgcgaccgaaatggtcaatctttatcgagatgctttagatcagggtaaaggggtg
gtgaaggaatggcgtcccatgaagccccattcttttaattggcagccttaccttaatcat
gaatgggatgctcaatacccccctaatacagttaaaatggcctctttaacagagttggca
aaaaaaatcagtcgtatccctgaaaaaatcgacatgcaatctcgagtcgctaaaatttat
gcagatcgtgcagaaatggccgcagggaagaaacccctcgattggggtgctgccgaaaca
ttagcctacgccaccttgctagataaaggcatttccattcgtttatcgggtgaagattca
gggcgtggcaccttttttcaccggaatgccgtgatttatgatcaaaaaaatggctcaaca
tatgtacctttagaaaacattcaccaacaccaaggtgactttaaggtctgggattcggtt
ttatctgaggaagcagtactggcttttgaatacggttattcgacagcggaacctcgtact
ttaaccatttgggaagcccagtttggtgattttgccaatggtgctcaggtggttatcgat
caatttatcagttctggagagcaaaaatggggtcgtatgtgtggtcttgtgatgttatta
ccacacggctatgaaggccaaggcccagagcactcttcagcacgtttagaacgctatctg
caactttgtgctgagcaaaatatccaggtctgcattccttctacgcctgcacaggtttac
catatgttgcgtcgtcaatcattaagacccatgagacgcccgttggtggtgatgtccccg
aaatcgttgcttcgccatcctttagcgatttcatctcttaaagaattagccgaaggcact
tttttgccggccatcggtgaaatggatgatctaaacagcgattctatcaaacgtgttgtg
atctgtgccggcaaagtgtattacgatctgttagaacaacgtcgtaaaaatcagcaagat
aatgtggcgattattcgtattgagcaactttacccttttccccatcaagcaataaaaatg
ctttttgagccctatgcgcatgtgcatgattttgtttggtgtcaagaagaacctctgaat
caaggggcctggtattgtagtcaacatcattttcgagaggtgatcccttttgctgcttcc
ttacgttatgcgggccggccggcctcagcctctccctctgtgggttatctctcagtgcat
caaaaacaacaaaaagatttgcttaacgacgctttaaccatggaatag

KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1888Help
Entry
HDEF_1888         CDS       T00911                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyltranssuccinate transferase, component of the 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00020  Citrate cycle (TCA cycle)
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
Module
hde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDEF_1888 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    HDEF_1888 (sucB)
   00380 Tryptophan metabolism
    HDEF_1888 (sucB)
Enzymes [BR:hde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HDEF_1888 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HTH_1
Motif
Other DBs
NCBI-ProteinID: ACQ68479
UniProt: C4K7D6
Position
1724866..1726152
Genome map
AA seq 428 aa AA seqDB search
MNNTDILVPDLPESVVDATVATWHKKPGERVQRDEVLVEIETDKVVLEVPASTSGILDSI
AEDEGATVVSRQKLGQMRLEDVFSESTSQKIQKSTSTSANEKKSSEKPASDVTNESQTIE
TLSPAIRRLIAEYELDARLIKATGPGGRMTREDVEQYLSAQNDSKKIPSQPISKSEASDI
SKNTAFSAAAEQMGIHRSEKRVPMTRLRKKISERLLQAKNNTAMLTTFNEVNMKPIMDLR
KKYGEAFEKSHGVRLGLMSFYVKAVIEALKRYPEINASIDDTDIVYHHYFDISIAVSTPR
GLVTPVLRDADTLSMADIEKQVKSLALKGRDGKLKVDELTGGNFTITNGGVFGSLMSTPI
INPPQSAILGMHTIQERPMAVKGQVVILPMMYLALSYDHRLVDGRESVGYLVTIKHMLED
PVRLLLDL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaataatacagatattctggtgcctgatttacctgagtctgtggtagatgccactgtg
gccacttggcataaaaaaccaggcgaaagggttcaacgcgatgaggttttagtggaaatt
gaaaccgataaagtcgttttagaagtcccagcaagcacttctggtatcctcgattcgata
gcagaggatgaaggcgccaccgtcgtttcacgccaaaaattgggtcaaatgcggctagaa
gatgtcttttctgaatctacgtctcaaaaaatacagaaaagcacatcgacctctgccaat
gaaaaaaaatccagtgagaagccagcgtcagatgtcacaaacgaatcacaaacaatagag
actttaagcccagccattcgtcgcctgattgctgagtatgagcttgatgctcgcctgatc
aaagccacgggcccgggtgggcgtatgactcgtgaagatgtcgaacaatatttatccgct
caaaacgattcaaaaaagatcccctctcaacctatctccaagagcgaggcttctgatatt
tcaaaaaataccgctttttctgctgctgcagagcagatgggcatacatcgtagtgaaaaa
cgtgtccccatgacgcgcctgcgtaaaaaaatctctgaacgcttgctgcaggcaaaaaat
aacacggccatgttaaccacttttaacgaagtgaatatgaagcccatcatggatttacgt
aaaaaatatggtgaggcttttgaaaaaagccatggcgtacgtttaggcttaatgtctttt
tatgtgaaagcggtgatagaagccctaaaacgctatcctgaaattaatgcctctattgat
gacacggatattgtgtatcaccattattttgatatcagtattgcggtttctacgccacgt
ggtcttgtcacacctgttctgcgtgatgcggataccttaagcatggcggatattgaaaaa
caggttaagtctctggcgctgaaagggcgtgacggtaagctcaaggttgacgaattaact
ggggggaattttaccattactaacggaggggtttttggttcactcatgtctacccccatc
attaatcctcctcaaagtgccattttgggcatgcataccatccaggagcgcccaatggca
gtcaaaggtcaggttgtgatcctcccaatgatgtatttagcgctctcgtatgaccaccgt
ttggtggatggtcgtgaatctgtaggttatttggtgaccatcaaacacatgcttgaggat
cccgttcgtttattgcttgatctataa

KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_2042Help
Entry
HDEF_2042         CDS       T00911                                 

Gene name
lpd_2
Definition
(GenBank) dihydrolipoamide dehydrogenase, FAD/NAD(P)-binding, component of the 2-oxoglutarate dehydrogenase and the pyruvate dehydrogenase complexes
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00010  Glycolysis / Gluconeogenesis
hde00020  Citrate cycle (TCA cycle)
hde00260  Glycine, serine and threonine metabolism
hde00280  Valine, leucine and isoleucine degradation
hde00620  Pyruvate metabolism
hde00630  Glyoxylate and dicarboxylate metabolism
hde00640  Propanoate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
Module
hde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hde_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDEF_2042 (lpd_2)
   00020 Citrate cycle (TCA cycle)
    HDEF_2042 (lpd_2)
   00620 Pyruvate metabolism
    HDEF_2042 (lpd_2)
   00630 Glyoxylate and dicarboxylate metabolism
    HDEF_2042 (lpd_2)
   00640 Propanoate metabolism
    HDEF_2042 (lpd_2)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HDEF_2042 (lpd_2)
   00280 Valine, leucine and isoleucine degradation
    HDEF_2042 (lpd_2)
   00310 Lysine degradation
    HDEF_2042 (lpd_2)
   00380 Tryptophan metabolism
    HDEF_2042 (lpd_2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hde04147]
    HDEF_2042 (lpd_2)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     HDEF_2042 (lpd_2)
Exosome [BR:hde04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   HDEF_2042 (lpd_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored GIDA NAD_binding_8 HI0933_like AlaDh_PNT_C FAD_binding_2 Thi4 FAD_binding_3 3HCDH_N Lycopene_cycl DAO UDPG_MGDP_dh_N FMO-like
Motif
Other DBs
NCBI-ProteinID: ACQ68614
UniProt: C4K7S1
Position
complement(1871451..1872884)
Genome map
AA seq 477 aa AA seqDB search
MKNTQVKTQVVVIGAGPAGYSAAFRCADLGLETLLVERYATLGGVCLNVGCIPSKALLHV
AKVISDTKTLEEHGVSFGAPKIDLKKMVGWKNNVIQKLTGGLSGMAKMRQVKVITGEAQF
SGSHTLLVKTQNAEQTEIRFDNAIIAAGSSAIELPFIPHEDPRIWNSTDALKLETIPKRL
LVMGGGIIGLEMATVYQALGSEIDVVEMSDQLIPAADKDVIKIFTKKIEKKFNIMLQTKV
TQVKAQEDGIFVTMEGNQDPEEHRYDAVLVAIGRKPNGKSLNAEKAGVTVDERGFICVDK
QLRTNIPHIFAVGDIVSQPMLAHKGVHEGHVAAEVISGLKHYFDPKVIPSIAYTEPEVAW
VGLTEKEAKQKGIEYEIAIFPWAASGRAIASDCSEGMTKLIFNKKTGRIMGGAIVGSNGG
ELLGEIGLAIEMGCDAEDMALTIHAHPTLYESVGLAAEIYEGSITDLPNSKAKKSKA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatactcaagtcaaaactcaagtcgtcgtgattggggcaggccctgcaggatat
tccgcggcatttcgctgtgcagatttagggttagaaacactattggttgaacgttacgcc
accttagggggagtgtgcttaaacgtgggttgcattccttctaaagcattactccatgtt
gctaaagtgatctcagacacaaaaacactagaagaacatggggtgagttttggcgcaccc
aaaattgatttaaagaaaatggtgggatggaaaaacaacgtaattcaaaagcttaccggt
ggattatcgggcatggcgaaaatgcgtcaggtcaaggtgataacaggcgaagctcaattt
agcggatctcacactctgttggtcaaaacccagaatgcagaacaaactgaaatccgcttt
gataatgcgattattgcggcgggttcgagcgcaatagaacttcctttcattccgcacgaa
gatcctcgcatttggaattcgactgatgcattgaaactagaaaccattccaaaacgttta
ttagtgatgggcggagggattatcggtttagaaatggcgaccgtttaccaagcactgggg
tcagagatcgacgtcgttgaaatgtcagatcaactgatccctgcggctgataaagacgtc
atcaaaattttcaccaaaaagatcgagaaaaaattcaatatcatgcttcaaaccaaggtc
actcaagtcaaagctcaagaggacggcatttttgtgacgatggaaggcaatcaagatcct
gaagagcaccgttatgatgcggttttggtggctattgggcggaaacccaatggaaaatcg
ctcaacgctgaaaaagcaggcgtgacggtggatgaacgtggttttatctgtgtggataaa
caattacgcaccaatattccccatatttttgcggtgggcgatattgtaagccaaccgatg
ttggcccataaaggcgtacacgaaggccatgtggccgcggaagtcatttcggggttaaaa
cactattttgatcccaaggtcattccttctattgcttatactgaacctgaagtcgcttgg
gtcggattaacagagaaagaagccaaacaaaaaggcattgagtatgaaatcgccattttc
ccctgggccgcttcaggtcgagccattgcttctgattgttcagaaggtatgactaagttg
atttttaataaaaagacgggtcgtattatgggcggtgcgattgtcggcagcaatggcgga
gaattactgggagaaatcgggctggccatcgaaatgggatgtgatgcggaagatatggcg
ttaaccatccatgctcacccaaccttatatgaatctgtgggattagcagctgaaatttat
gaaggcagcatcaccgatttgcctaattcgaaagcaaaaaaaagtaaagcataa

DBGET integrated database retrieval system