KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1889Help
Entry
HDEF_1889         CDS       T00911                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00020  Citrate cycle (TCA cycle)
hde00640  Propanoate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
Module
hde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDEF_1889 (sucC)
   00640 Propanoate metabolism
    HDEF_1889 (sucC)
   00660 C5-Branched dibasic acid metabolism
    HDEF_1889 (sucC)
Enzymes [BR:hde01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HDEF_1889 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ACQ68480
UniProt: C4K7D7
Position
1726270..1727436
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKELFARRGLPVPKGYVCRSAGEAEKATTELGGDLWVAKCQVHAGGRGKSGGV
KLCNNPQDVSAFAEQWLGKNLVTYQTDLQGQPVHHILVEAATDIAQELYLGAVIDRSSSR
VVFMASTEGGVEIEKVAEKTPHLIHKVTIDPLTGPQPFQGRELAFQLGLTGKKVSQFSQI
FMNLAKLFLECDLALLEINPLVITKKEELICLDAKLTVDGNALYRQPELRQIHDVTQEDA
REAHAAQFELNYVALEGNIGCMVNGAGLAMGTMDMVKLYGAEPANFLDVGGGATKERVTE
AFKIILSDEKVKAILVNIFGGIVRCDLIADGIIAAVAEVGMQIPVVVRLEGNNAKPGAKK
LSDSGLNIIAANSLTHAAKQIAAAVKEK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgaatatcaagcaaaagaattatttgctcggcggggcttgcctgttcca
aaagggtatgtctgtcgctcagcgggtgaagcagaaaaagcgaccacagagcttggcgga
gatctttgggtcgcaaaatgtcaagtgcatgcagggggcagagggaaatcggggggggtc
aaattatgtaacaacccgcaagatgtcagcgcttttgccgagcagtggttgggtaaaaat
ttggtgacctaccaaaccgatctgcagggtcagcctgttcatcacattttggtagaggct
gcaacagatattgctcaagaattatatcttggcgctgtgatagaccgcagttcaagccgt
gtcgtttttatggcctctaccgaaggaggcgttgagattgaaaaagtcgcagaaaaaacc
ccgcatctcattcacaaagtgacgatcgatcctttgacgggaccacagcctttccaaggg
cgtgaactggcatttcaactgggattaactggtaaaaaagtcagccagttcagtcagatt
ttcatgaatttagcaaaactgtttttagaatgtgatttagcgctactagaaattaaccct
ttggtcatcaccaaaaaggaagaacttatttgcttggacgcaaaattaaccgtagatggt
aacgccctatataggcaacctgaattacgtcagattcatgatgtcacgcaagaagatgcc
cgtgaagcgcacgcggcgcaatttgaattaaattatgtggcgttagagggcaatattggg
tgcatggtcaatggcgcgggccttgccatgggcacaatggatatggtgaaactgtatggt
gctgaacctgctaattttttggatgttggcgggggagccaccaaagaacgtgttacagag
gcttttaaaattattttgtctgacgaaaaagtcaaagcgattttagttaatatttttggg
gggattgtacgctgcgatttaattgcagatggcattatcgctgcagttgccgaagtgggt
atgcaaatccccgtcgtggtccgtcttgaaggtaacaatgccaaaccaggggctaaaaaa
ttgtctgacagtggccttaatattattgccgcaaacagtttaacccatgcggcaaagcaa
attgctgcagcagtgaaggaaaaataa

KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1890Help
Entry
HDEF_1890         CDS       T00911                                 

Gene name
sucD
Definition
(GenBank) succinyl-CoA synthetase, alpha subunit, NAD(P)-binding
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00020  Citrate cycle (TCA cycle)
hde00640  Propanoate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
Module
hde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDEF_1890 (sucD)
   00640 Propanoate metabolism
    HDEF_1890 (sucD)
   00660 C5-Branched dibasic acid metabolism
    HDEF_1890 (sucD)
Enzymes [BR:hde01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HDEF_1890 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: ACQ68481
UniProt: C4K7D8
Position
1727436..1728308
Genome map
AA seq 290 aa AA seqDB search
MSILVDKNTKVICQGFTGSQGTFHSEHAIAYGTQMVGGVTPGKGGTTHLGLPVFNTVKEA
VLKTGATASVIYVPAPFCKDSILEAIDAGITLIVCITEGIPTLDMLIVKEKLKQSHVRMI
GPNCPGIITPGACKIGIMPGHIHRPGKVGIVSRSGTLTYEAVKQTTDAGLGQSTCVGIGG
DPISGSHFIDILTLFEQDPQTEAIVMIGEIGGNAEEETADYIKNTSFKKLVVAYIAGVTA
PKGKRMGHAGAIISGGRGTAEEKFLALEAAGVKTVHSLTDIGQTVINILS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtctattttagtggataaaaataccaaagtcatttgccagggttttacgggcagccaa
ggcactttccattcagaacacgccatcgcttatggcactcaaatggttggaggcgtcact
ccaggtaaaggaggaactacccatttaggcttacctgtatttaatacggtcaaagaagcg
gttttaaaaactggggcaacggcttctgttatttatgtgcctgcgcctttttgcaaagat
tctattcttgaagccatcgatgcgggcataactctgattgtttgcattacggaaggcatt
ccgacgttagacatgctgatcgtcaaagagaaactcaagcaaagccatgtgagaatgata
ggccccaattgccctgggattattacgcctggcgcctgtaaaattgggattatgcctggt
catattcatcgtccgggcaaggttggcattgtgtcacgctcaggcacattaacttatgaa
gccgtcaaacaaaccaccgatgctggtttaggccaatcgacctgtgtgggtattggaggc
gaccctatttcaggctctcatttcattgatattttgacgttgtttgaacaggatcctcaa
acagaagcaattgtcatgataggtgaaattggtggaaacgcagaagaagaaaccgcagat
tacatcaaaaatacgtcatttaaaaaactggtcgtggcttatatcgcaggagtgacagcg
ccgaaaggaaagcgtatgggacatgcgggcgccatcatttcaggaggacgagggaccgcg
gaagaaaaatttttagccctggaagcggcgggggtaaaaacggtccatagcctgaccgat
attggccaaacggtgatcaacattttatcataa

DBGET integrated database retrieval system