KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1897Help
Entry
HDEF_1897         CDS       T00911                                 

Gene name
folD
Definition
(GenBank) bifunctional: 5,10-methylene-tetrahydrofolate dehydrogenase; 5,10-methylene-tetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00670  One carbon pool by folate
hde01100  Metabolic pathways
hde01120  Microbial metabolism in diverse environments
hde01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    HDEF_1897 (folD)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     HDEF_1897 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     HDEF_1897 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ACQ68487
UniProt: C4K7E4
Position
complement(1735018..1735869)
Genome map
AA seq 283 aa AA seqDB search
MSAKIMDGKSIAQQIKNEVAHGVQKRLKQGKRAPGLAVILIGENSASQIYVANKRKACEE
VGFVSHCYPLPETTSKAELVSLIKQLNQDPEIDGILVQLPLPERFDSANMLEQIRPDKDV
DGFHPYNIGSLCQRIPKLRPCTPLGIMTLLARYDLDPCGLNALVVGASNIVGRPMSLELL
LAGCTTTVAHRFTQHLQQHVENADLLVVAVGKPSFIPGTWIKPGAIVIDVGINRLQNGRV
VGDVEFDMAATRAAWITPVPGGVGPMTVASLLQNTLKACMERT
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccaaaattatggatggtaaatccatcgcgcagcaaatcaaaaatgaagtcgcc
catggcgtacaaaaacgcctcaaacaagggaaacgtgcccctggtctggcggtgatatta
atcggtgaaaatagtgcgtctcagatttatgtggcgaataaacgtaaggcctgtgaagaa
gttgggtttgtttcgcattgttatccgttgccagaaacaacctctaaagcagaactggtg
tctttaataaagcagcttaatcaagatcctgagatagatggcatcttggttcagttgcct
ctaccggaacgctttgatagcgcgaacatgttagaacagatacgccccgataaagatgtc
gatgggtttcatccttataacattggctctttatgtcaaaggataccgaaattacgcccc
tgcacacctctgggcatcatgaccttactggcgcgctacgatctcgatccttgtggcttg
aatgccttggtcgtgggcgcctctaacattgtggggcggccgatgagcctggaattgttg
ctggccggttgtaccaccacggtcgcacatagattcactcaacatctccagcaacatgtt
gaaaacgcggatttactggtggtggcagtggggaaaccctcttttatccctggaacctgg
atcaaacccggcgcgattgtgatagatgttggtattaatagattgcaaaatggtcgcgtg
gtaggggacgtagaatttgatatggctgcaaccagagcggcatggatcacgcctgttcct
ggcggagtcggccctatgacggtggccagcttgttgcaaaatacgctaaaagcctgtatg
gaacgcacttga

DBGET integrated database retrieval system