KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_1899Help
Entry
HDEF_1899         CDS       T00911                                 

Gene name
thrB
Definition
(GenBank) homoserine kinase
  KO
K00872  homoserine kinase [EC:2.7.1.39]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00260  Glycine, serine and threonine metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01230  Biosynthesis of amino acids
Module
hde_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HDEF_1899 (thrB)
Enzymes [BR:hde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     HDEF_1899 (thrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C Cry1Ac_D5
Motif
Other DBs
NCBI-ProteinID: ACQ68489
UniProt: C4K7E6
Position
complement(1737214..1738143)
Genome map
AA seq 309 aa AA seqDB search
MLKFFAPASIGNLGVGFDVLGMAISPIDGTLLGDCLSIAPAEQFDLEIKGSFSDKLPKEP
KKNIVFRCWKNFCQKIGKDVPVQMRLEKNMPVGSGLGSSACSVVAALVAMNEYCAHPLDQ
NALLSLMGEMEGLISGNVHYDNVAPCYLGGLQFILDTQSRISQSIPLFSDWLWVLAYPGI
KISTAKARNVLPVHYSKRDCVDHGRYLAGFIHACYSQQPDLAAELMKDVIAEPYRLPMLP
SFLTARQKAKEMGALATGISGSGPTLFSVCPNLKTATSISDWLQHHYLENDAGFVHICRL
DSLGARSVG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaattttttgcacccgcatccattggtaatttgggcgtgggttttgatgtatta
ggaatggcaatatcgcctattgacgggaccttactcggcgattgtttaagcatcgccccg
gcagaacagtttgatctggagattaaagggtctttttccgataaattacctaaagagccc
aaaaaaaatatcgtctttcggtgctggaaaaatttttgccaaaaaataggcaaagatgtg
ccggtgcaaatgcggttagagaaaaatatgcccgtggggtcaggattgggatccagcgcg
tgttctgtggttgcggccctggtggccatgaatgaatattgtgcgcatccgctggatcaa
aacgcgttgctttctttaatgggggaaatggaaggcctgatttcaggcaatgttcattat
gataatgtggcgccctgttatttaggcgggctgcagttcatattagacacacaaagcagg
atcagccagagcattccccttttttctgattggctttgggtcctcgcttatccaggcatt
aaaatttcgacggccaaagccagaaatgtgttgcccgtccactattccaaacgcgattgt
gtggatcatgggcgttatttggctggttttattcatgcgtgttacagccaacagcctgat
ttagcggcagaattaatgaaagatgtcattgcagaaccctatcgtttacccatgctgcct
tcttttttaaccgctcgtcaaaaagcgaaagaaatgggcgcattagcaaccggtatttct
ggatccggccccactctgtttagcgtttgtcccaacctgaaaaccgccacgagcatctca
gactggctccagcatcattatttagagaacgacgcaggttttgtacatatctgtcgcctg
gatagcctgggtgcacgatcagtaggataa

DBGET integrated database retrieval system