KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_2042Help
Entry
HDEF_2042         CDS       T00911                                 

Gene name
lpd_2
Definition
(GenBank) dihydrolipoamide dehydrogenase, FAD/NAD(P)-binding, component of the 2-oxoglutarate dehydrogenase and the pyruvate dehydrogenase complexes
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00010  Glycolysis / Gluconeogenesis
hde00020  Citrate cycle (TCA cycle)
hde00260  Glycine, serine and threonine metabolism
hde00280  Valine, leucine and isoleucine degradation
hde00620  Pyruvate metabolism
hde00630  Glyoxylate and dicarboxylate metabolism
hde00640  Propanoate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
Module
hde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hde_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDEF_2042 (lpd_2)
   00020 Citrate cycle (TCA cycle)
    HDEF_2042 (lpd_2)
   00620 Pyruvate metabolism
    HDEF_2042 (lpd_2)
   00630 Glyoxylate and dicarboxylate metabolism
    HDEF_2042 (lpd_2)
   00640 Propanoate metabolism
    HDEF_2042 (lpd_2)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HDEF_2042 (lpd_2)
   00280 Valine, leucine and isoleucine degradation
    HDEF_2042 (lpd_2)
   00310 Lysine degradation
    HDEF_2042 (lpd_2)
   00380 Tryptophan metabolism
    HDEF_2042 (lpd_2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hde04147]
    HDEF_2042 (lpd_2)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     HDEF_2042 (lpd_2)
Exosome [BR:hde04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   HDEF_2042 (lpd_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored GIDA NAD_binding_8 HI0933_like AlaDh_PNT_C FAD_binding_2 Thi4 FAD_binding_3 3HCDH_N Lycopene_cycl DAO UDPG_MGDP_dh_N FMO-like
Motif
Other DBs
NCBI-ProteinID: ACQ68614
UniProt: C4K7S1
Position
complement(1871451..1872884)
Genome map
AA seq 477 aa AA seqDB search
MKNTQVKTQVVVIGAGPAGYSAAFRCADLGLETLLVERYATLGGVCLNVGCIPSKALLHV
AKVISDTKTLEEHGVSFGAPKIDLKKMVGWKNNVIQKLTGGLSGMAKMRQVKVITGEAQF
SGSHTLLVKTQNAEQTEIRFDNAIIAAGSSAIELPFIPHEDPRIWNSTDALKLETIPKRL
LVMGGGIIGLEMATVYQALGSEIDVVEMSDQLIPAADKDVIKIFTKKIEKKFNIMLQTKV
TQVKAQEDGIFVTMEGNQDPEEHRYDAVLVAIGRKPNGKSLNAEKAGVTVDERGFICVDK
QLRTNIPHIFAVGDIVSQPMLAHKGVHEGHVAAEVISGLKHYFDPKVIPSIAYTEPEVAW
VGLTEKEAKQKGIEYEIAIFPWAASGRAIASDCSEGMTKLIFNKKTGRIMGGAIVGSNGG
ELLGEIGLAIEMGCDAEDMALTIHAHPTLYESVGLAAEIYEGSITDLPNSKAKKSKA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatactcaagtcaaaactcaagtcgtcgtgattggggcaggccctgcaggatat
tccgcggcatttcgctgtgcagatttagggttagaaacactattggttgaacgttacgcc
accttagggggagtgtgcttaaacgtgggttgcattccttctaaagcattactccatgtt
gctaaagtgatctcagacacaaaaacactagaagaacatggggtgagttttggcgcaccc
aaaattgatttaaagaaaatggtgggatggaaaaacaacgtaattcaaaagcttaccggt
ggattatcgggcatggcgaaaatgcgtcaggtcaaggtgataacaggcgaagctcaattt
agcggatctcacactctgttggtcaaaacccagaatgcagaacaaactgaaatccgcttt
gataatgcgattattgcggcgggttcgagcgcaatagaacttcctttcattccgcacgaa
gatcctcgcatttggaattcgactgatgcattgaaactagaaaccattccaaaacgttta
ttagtgatgggcggagggattatcggtttagaaatggcgaccgtttaccaagcactgggg
tcagagatcgacgtcgttgaaatgtcagatcaactgatccctgcggctgataaagacgtc
atcaaaattttcaccaaaaagatcgagaaaaaattcaatatcatgcttcaaaccaaggtc
actcaagtcaaagctcaagaggacggcatttttgtgacgatggaaggcaatcaagatcct
gaagagcaccgttatgatgcggttttggtggctattgggcggaaacccaatggaaaatcg
ctcaacgctgaaaaagcaggcgtgacggtggatgaacgtggttttatctgtgtggataaa
caattacgcaccaatattccccatatttttgcggtgggcgatattgtaagccaaccgatg
ttggcccataaaggcgtacacgaaggccatgtggccgcggaagtcatttcggggttaaaa
cactattttgatcccaaggtcattccttctattgcttatactgaacctgaagtcgcttgg
gtcggattaacagagaaagaagccaaacaaaaaggcattgagtatgaaatcgccattttc
ccctgggccgcttcaggtcgagccattgcttctgattgttcagaaggtatgactaagttg
atttttaataaaaagacgggtcgtattatgggcggtgcgattgtcggcagcaatggcgga
gaattactgggagaaatcgggctggccatcgaaatgggatgtgatgcggaagatatggcg
ttaaccatccatgctcacccaaccttatatgaatctgtgggattagcagctgaaatttat
gaaggcagcatcaccgatttgcctaattcgaaagcaaaaaaaagtaaagcataa

KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_2043Help
Entry
HDEF_2043         CDS       T00911                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase, dihydrolipoyltransacetylase subunit
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00010  Glycolysis / Gluconeogenesis
hde00020  Citrate cycle (TCA cycle)
hde00620  Pyruvate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
Module
hde_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDEF_2043 (aceF)
   00020 Citrate cycle (TCA cycle)
    HDEF_2043 (aceF)
   00620 Pyruvate metabolism
    HDEF_2043 (aceF)
Enzymes [BR:hde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HDEF_2043 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA
Motif
Other DBs
NCBI-ProteinID: ACQ68615
UniProt: C4K7S2
Position
complement(1872901..1874496)
Genome map
AA seq 531 aa AA seqDB search
MVIEIKMPDIGTDTPEVIEIMVKVGDVVVPEQTLLCVEGDKASMDIPSPQEGTIKEIKVS
VGDKVETGKLIMLFESSTEAVPEKKGKTQVPAPAIPAQENTKTVSLPDVGSDELEVTEIL
VKVGDSVTEEQSLITVEGDKASMEVPAPFSGTVKEIQIKTGDKVKTGSMIMIMNTIEKIT
PAPDQKIQKTADALPEQKPEIPPSKPSAPSNTTTSIEKTTPSFTEEAYTHATPVIRRLAR
ELGVNLEKVAGTGRKGRILKEDVQSYVKNAVQTAESASSGQGNLTPLLPWPKIDFNQFGE
TEEIALTRIQKMSGDNLSRNWVMIPHVTQFDETDITDLEDFRKKQNIEAEKRKLDVKITP
VVFMMKAVAQALKTFPRFNSSLSLDGKKLILKKYINIGVAVDTPNGLVVPVFRDVNKKGV
IELSKELMLISQKARSGKLTASDMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSKSA
IKPIWNGKEFLPRLMLPLSLSFDHRVIDGAAGARFVSHISVIMADIRRLIM
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggtgattgaaattaaaatgcctgatatcggtacagacaccccagaagtcatcgaaatc
atggtaaaggtcggcgatgtcgtggtgccagagcaaacgctgctttgtgttgaaggagat
aaagcgtcaatggacattccctctccacaagaaggcacgataaaggaaatcaaagtttcc
gtcggagataaagtcgaaaccggcaaattgatcatgctttttgaatccagcacagaggct
gtcccagaaaaaaaagggaagacacaagtaccagcccctgccatacctgctcaagaaaac
acaaagacagtgtctttaccggatgtgggatctgatgaattagaagtcacagagatttta
gtcaaagtgggggactcggtaacagaagaacaatctttgatcaccgtagaaggggataaa
gcttccatggaagtgccagcccctttttcaggcacagtgaaagaaattcaaataaaaaca
ggggataaagtcaaaaccggttcgatgatcatgatcatgaatacaatagagaaaatcaca
ccggcacccgatcaaaaaattcaaaaaacggcagatgcactgcctgagcaaaaaccagaa
atccccccttccaagcccagcgcaccttcgaacacgacaacaagcatagaaaaaacaact
ccttccttcacagaggaagcttatacgcatgcgacgccagtgattcgccgtttggcgcgt
gaattgggcgttaatcttgaaaaagtcgcagggaccggccgcaaagggcgcatcttgaaa
gaagatgtccaatcttatgttaaaaatgcagtacagactgcagaatccgcatcttctggc
caaggaaacctaacgccccttttgccttggccaaagatcgactttaatcaatttggtgag
accgaagaaatagcattaacacgaattcaaaaaatgtctggggataatctcagccgtaac
tgggtcatgatccctcatgtcacccaatttgatgaaacagacatcacggaccttgaagat
tttcgcaaaaaacaaaacatcgaagcggaaaaaaggaagctcgacgttaaaatcacgcct
gtcgtctttatgatgaaagctgtagcgcaggccttaaaaaccttcccccgctttaacagt
tccctgtcgttggatgggaaaaaactgattttaaaaaaatacatcaacattggggtggcg
gtcgatacaccgaatggcctggtcgtgcctgtttttcgtgacgtgaacaaaaaaggcgtg
attgagctatccaaagaactgatgttgatttctcaaaaggcacgctcaggtaaattaacc
gcttcggatatgcaggggggctgctttaccatttccagtttaggcgggattgggggaacg
gcattcacgccgattgtgaatgcccctgaagtggccattcttggcgtgtcaaaatctgcc
atcaaacccatttggaacgggaaagaatttcttcctcgtttaatgctgcctttatcactg
tctttcgatcatagggtgattgacggcgcggcaggcgctcgtttcgtgagtcatatcagc
gttatcatggctgatattcgtcgtctgattatgtaa

KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_2044Help
Entry
HDEF_2044         CDS       T00911                                 

Gene name
aceE
Definition
(GenBank) pyruvate dehydrogenase, decarboxylase subunit, thiamin-binding
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00010  Glycolysis / Gluconeogenesis
hde00020  Citrate cycle (TCA cycle)
hde00620  Pyruvate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
Module
hde_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDEF_2044 (aceE)
   00020 Citrate cycle (TCA cycle)
    HDEF_2044 (aceE)
   00620 Pyruvate metabolism
    HDEF_2044 (aceE)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     HDEF_2044 (aceE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH_E1_M Transketolase_N
Motif
Other DBs
NCBI-ProteinID: ACQ68616
UniProt: C4K7S3
Position
complement(1874523..1877189)
Genome map
AA seq 888 aa AA seqDB search
MSDPLSNNDVDPIETQDWRKSIESVIREEGAERAQYLIDQVLSAAQKMGAPLSQISLQKN
YINSISTEEEPPYPGDLKLERRIRAAIRWNAIMMVLKASKKDLDLGGHIASFQSFATFYE
VCFHHFFRAPNQHDGGDLVFFQGHISPGIYARAFLEGRLTEEQLDHFRQEVEGKGLSSYP
HPKLMPEFWQFPTVSMGLGPLNAIYQAKFLKYLEHRVLKDTSKQRVYAFLGDGEMDEPES
KGAITIAAREKLDNLVFIINCNLQRLDGPVTGNGKIIDELEGIFSGAGWQVIKVIWGGRW
DDLLSRDTSGKLVQLMNETVDGDYQTFKSKNGAYVREHFFGRYPETAALVKDMSDDEIWA
LNRGGHDPVKIFAALKKAQETKGKPTLILAHTIKGYGMGEAGEGKNIAHQLKKINMEGIR
YLRDRFNIAVKDEDIEKLPYVTFEKESEEEKYLHHQRQSLGGYLPSRLKNFTQKLELPSL
QDFSALFQEQTKHISTTIAFVRVLNVMLKNKFIKDRIVPIIADEARTFGMEGLFRQIGIY
NPGGQQYVPQDREQVAYYKEDAKGQILQEGINELGAASSWLAAATSYSTNDLPMIPFYIY
YSIFGFQRIGDLCWAAGDQQARGFLIGGTSGRTTLNGEGLQHEDGHSHIQSLTIPNCISY
DPAYAYEVAVIMHQGLERMYGEAQENVYYYLTTLNENYHMPAMPKGAEEGIGKGIYLLES
LPGKKSRLQLMGSGAILRHVREAAQILSQQYDIASDVYSVTSFTELARDGQDCERWNMLH
PAETPKVPYVAQILHQAPVIASTDYMKLFAEQIRPFIPTRHFRVLGTDGYGRSDSRENLR
HHFEVNAAYVVIAALTELTKIGVFNPEEVQEAMIKFNIDPNKPNPRLA
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatcctttatcaaacaatgacgtggatcccatcgaaacacaagactggcgaaag
tcgattgaatcggtgatccgtgaagaaggtgctgagcgtgctcagtatctgatagatcaa
gttttaagtgccgctcaaaaaatgggagcccctctttctcaaatatctctccaaaaaaat
tatatcaattctatctcaacagaagaagaacccccttatccaggggatttaaaactagaa
cgccgtattagagcggcgattcgttggaatgccatcatgatggttctaaaagcgtcgaaa
aaagatttagatttgggcgggcatattgcgtcctttcaatcttttgcgaccttttatgaa
gtctgctttcatcatttttttcgtgcccctaatcaacacgacggtggagatttggttttc
tttcaaggccatatctccccgggtatttacgctcgtgcttttttagaaggtcgtttaacc
gaagagcaactcgatcattttcgccaagaagtcgaaggaaaaggtctttcttcttatcct
caccctaaattaatgccggaattttggcaattcccgaccgtttctatgggcttagggcct
cttaatgccatctatcaagccaaatttttaaaatatcttgaacacagagtcttaaaagac
acctctaagcaacgggtatacgcctttctaggagacggagaaatggatgaacccgaatcc
aaaggcgctattaccatcgccgctcgagaaaagcttgataatttggtgtttattattaat
tgcaacttacagcgtcttgatggccccgtaaccggcaatgggaaaattattgatgagctc
gaaggcatttttagtggcgcaggttggcaggtcatcaaggtaatttggggagggcgctgg
gatgatctactgagtagagataccagtggtaagctagtccaattgatgaatgaaactgta
gatggcgattaccaaacctttaaatctaaaaatggcgcttatgtacgcgaacactttttt
gggcgatatcctgaaacggcagctttagtcaaagatatgagcgatgatgagatatgggcg
ctcaacagagggggccatgatcctgttaaaatttttgcggccttaaaaaaagcacaggag
accaagggaaaaccaaccctgattctggctcatactattaaaggctatgggatgggtgag
gcgggtgaaggaaaaaatattgctcatcaacttaaaaagatcaatatggaagggatacgc
tatttgagggatcgttttaacatcgctgtcaaagacgaagacattgaaaaattgccttac
gtcacctttgaaaaggagtctgaagaagagaaatatctgcatcatcaacgtcaatcttta
ggcggatatttaccctctcgtttgaaaaatttcacgcaaaaactagagctcccctcactg
caagatttcagcgctctgtttcaagagcaaacaaaacacatctctacgaccatcgctttt
gtgcgcgtattgaatgtgatgttaaaaaataaatttattaaagatcgaattgtgcctatc
atcgccgatgaagcacgtacctttggcatggaagggttgtttcgccaaattggcatttac
aaccccggcggtcagcaatatgtcccgcaggatcgtgaacaagtcgcttattataaagag
gatgccaaagggcaaattttacaggaagggattaatgagctgggcgccgcttcttcctgg
ttagccgcggccacgtcttatagcacgaacgatctcccgatgattcctttttatatctat
tattctatatttgggtttcaacggattggcgatctgtgctgggcagcaggtgatcaacag
gcacgtggatttttgataggcggcacttcgggccgtaccacgctcaatggggaaggttta
cagcatgaagacggtcatagtcacattcaatcgttaaccattccaaattgtatttcttac
gatcctgcttatgcgtatgaagtggctgtcattatgcatcagggccttgaaaggatgtat
ggcgaagcgcaagaaaatgtttactattatttgaccaccttaaatgaaaattatcacatg
cccgcgatgccaaagggagcagaagaaggcataggcaaaggcatttatttgttagaaagt
ctgcctggtaaaaaatccaggcttcagttaatgggatcaggggctattttgcgtcacgtt
cgcgaggcggctcaaattttatctcaacagtatgacattgcctctgatgtctacagtgtg
acttcatttactgaattggcacgtgatggtcaagattgtgagagatggaacatgttgcac
ccagccgaaacaccgaaggtgccttatgttgcccaaattttgcatcaagccccggtgatt
gcctccacggattacatgaaattatttgctgaacaaattcggcctttcattcccactcgt
cattttcgtgttttaggaacagacggttacgggcgttccgatagccgtgaaaatttacga
catcactttgaggtcaatgcggcttatgtggtcattgctgcattgacagagctcaccaaa
ataggggtttttaatcctgaagaagttcaagaagcgatgataaagtttaatatcgatccg
aataaaccaaatccccgtttagcataa

DBGET integrated database retrieval system