KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_2043Help
Entry
HDEF_2043         CDS       T00911                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase, dihydrolipoyltransacetylase subunit
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00010  Glycolysis / Gluconeogenesis
hde00020  Citrate cycle (TCA cycle)
hde00620  Pyruvate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
Module
hde_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDEF_2043 (aceF)
   00020 Citrate cycle (TCA cycle)
    HDEF_2043 (aceF)
   00620 Pyruvate metabolism
    HDEF_2043 (aceF)
Enzymes [BR:hde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HDEF_2043 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA
Motif
Other DBs
NCBI-ProteinID: ACQ68615
UniProt: C4K7S2
Position
complement(1872901..1874496)
Genome map
AA seq 531 aa AA seqDB search
MVIEIKMPDIGTDTPEVIEIMVKVGDVVVPEQTLLCVEGDKASMDIPSPQEGTIKEIKVS
VGDKVETGKLIMLFESSTEAVPEKKGKTQVPAPAIPAQENTKTVSLPDVGSDELEVTEIL
VKVGDSVTEEQSLITVEGDKASMEVPAPFSGTVKEIQIKTGDKVKTGSMIMIMNTIEKIT
PAPDQKIQKTADALPEQKPEIPPSKPSAPSNTTTSIEKTTPSFTEEAYTHATPVIRRLAR
ELGVNLEKVAGTGRKGRILKEDVQSYVKNAVQTAESASSGQGNLTPLLPWPKIDFNQFGE
TEEIALTRIQKMSGDNLSRNWVMIPHVTQFDETDITDLEDFRKKQNIEAEKRKLDVKITP
VVFMMKAVAQALKTFPRFNSSLSLDGKKLILKKYINIGVAVDTPNGLVVPVFRDVNKKGV
IELSKELMLISQKARSGKLTASDMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSKSA
IKPIWNGKEFLPRLMLPLSLSFDHRVIDGAAGARFVSHISVIMADIRRLIM
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggtgattgaaattaaaatgcctgatatcggtacagacaccccagaagtcatcgaaatc
atggtaaaggtcggcgatgtcgtggtgccagagcaaacgctgctttgtgttgaaggagat
aaagcgtcaatggacattccctctccacaagaaggcacgataaaggaaatcaaagtttcc
gtcggagataaagtcgaaaccggcaaattgatcatgctttttgaatccagcacagaggct
gtcccagaaaaaaaagggaagacacaagtaccagcccctgccatacctgctcaagaaaac
acaaagacagtgtctttaccggatgtgggatctgatgaattagaagtcacagagatttta
gtcaaagtgggggactcggtaacagaagaacaatctttgatcaccgtagaaggggataaa
gcttccatggaagtgccagcccctttttcaggcacagtgaaagaaattcaaataaaaaca
ggggataaagtcaaaaccggttcgatgatcatgatcatgaatacaatagagaaaatcaca
ccggcacccgatcaaaaaattcaaaaaacggcagatgcactgcctgagcaaaaaccagaa
atccccccttccaagcccagcgcaccttcgaacacgacaacaagcatagaaaaaacaact
ccttccttcacagaggaagcttatacgcatgcgacgccagtgattcgccgtttggcgcgt
gaattgggcgttaatcttgaaaaagtcgcagggaccggccgcaaagggcgcatcttgaaa
gaagatgtccaatcttatgttaaaaatgcagtacagactgcagaatccgcatcttctggc
caaggaaacctaacgccccttttgccttggccaaagatcgactttaatcaatttggtgag
accgaagaaatagcattaacacgaattcaaaaaatgtctggggataatctcagccgtaac
tgggtcatgatccctcatgtcacccaatttgatgaaacagacatcacggaccttgaagat
tttcgcaaaaaacaaaacatcgaagcggaaaaaaggaagctcgacgttaaaatcacgcct
gtcgtctttatgatgaaagctgtagcgcaggccttaaaaaccttcccccgctttaacagt
tccctgtcgttggatgggaaaaaactgattttaaaaaaatacatcaacattggggtggcg
gtcgatacaccgaatggcctggtcgtgcctgtttttcgtgacgtgaacaaaaaaggcgtg
attgagctatccaaagaactgatgttgatttctcaaaaggcacgctcaggtaaattaacc
gcttcggatatgcaggggggctgctttaccatttccagtttaggcgggattgggggaacg
gcattcacgccgattgtgaatgcccctgaagtggccattcttggcgtgtcaaaatctgcc
atcaaacccatttggaacgggaaagaatttcttcctcgtttaatgctgcctttatcactg
tctttcgatcatagggtgattgacggcgcggcaggcgctcgtttcgtgagtcatatcagc
gttatcatggctgatattcgtcgtctgattatgtaa

DBGET integrated database retrieval system