KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_2044Help
Entry
HDEF_2044         CDS       T00911                                 

Gene name
aceE
Definition
(GenBank) pyruvate dehydrogenase, decarboxylase subunit, thiamin-binding
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00010  Glycolysis / Gluconeogenesis
hde00020  Citrate cycle (TCA cycle)
hde00620  Pyruvate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
Module
hde_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDEF_2044 (aceE)
   00020 Citrate cycle (TCA cycle)
    HDEF_2044 (aceE)
   00620 Pyruvate metabolism
    HDEF_2044 (aceE)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     HDEF_2044 (aceE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH_E1_M Transketolase_N
Motif
Other DBs
NCBI-ProteinID: ACQ68616
UniProt: C4K7S3
Position
complement(1874523..1877189)
Genome map
AA seq 888 aa AA seqDB search
MSDPLSNNDVDPIETQDWRKSIESVIREEGAERAQYLIDQVLSAAQKMGAPLSQISLQKN
YINSISTEEEPPYPGDLKLERRIRAAIRWNAIMMVLKASKKDLDLGGHIASFQSFATFYE
VCFHHFFRAPNQHDGGDLVFFQGHISPGIYARAFLEGRLTEEQLDHFRQEVEGKGLSSYP
HPKLMPEFWQFPTVSMGLGPLNAIYQAKFLKYLEHRVLKDTSKQRVYAFLGDGEMDEPES
KGAITIAAREKLDNLVFIINCNLQRLDGPVTGNGKIIDELEGIFSGAGWQVIKVIWGGRW
DDLLSRDTSGKLVQLMNETVDGDYQTFKSKNGAYVREHFFGRYPETAALVKDMSDDEIWA
LNRGGHDPVKIFAALKKAQETKGKPTLILAHTIKGYGMGEAGEGKNIAHQLKKINMEGIR
YLRDRFNIAVKDEDIEKLPYVTFEKESEEEKYLHHQRQSLGGYLPSRLKNFTQKLELPSL
QDFSALFQEQTKHISTTIAFVRVLNVMLKNKFIKDRIVPIIADEARTFGMEGLFRQIGIY
NPGGQQYVPQDREQVAYYKEDAKGQILQEGINELGAASSWLAAATSYSTNDLPMIPFYIY
YSIFGFQRIGDLCWAAGDQQARGFLIGGTSGRTTLNGEGLQHEDGHSHIQSLTIPNCISY
DPAYAYEVAVIMHQGLERMYGEAQENVYYYLTTLNENYHMPAMPKGAEEGIGKGIYLLES
LPGKKSRLQLMGSGAILRHVREAAQILSQQYDIASDVYSVTSFTELARDGQDCERWNMLH
PAETPKVPYVAQILHQAPVIASTDYMKLFAEQIRPFIPTRHFRVLGTDGYGRSDSRENLR
HHFEVNAAYVVIAALTELTKIGVFNPEEVQEAMIKFNIDPNKPNPRLA
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatcctttatcaaacaatgacgtggatcccatcgaaacacaagactggcgaaag
tcgattgaatcggtgatccgtgaagaaggtgctgagcgtgctcagtatctgatagatcaa
gttttaagtgccgctcaaaaaatgggagcccctctttctcaaatatctctccaaaaaaat
tatatcaattctatctcaacagaagaagaacccccttatccaggggatttaaaactagaa
cgccgtattagagcggcgattcgttggaatgccatcatgatggttctaaaagcgtcgaaa
aaagatttagatttgggcgggcatattgcgtcctttcaatcttttgcgaccttttatgaa
gtctgctttcatcatttttttcgtgcccctaatcaacacgacggtggagatttggttttc
tttcaaggccatatctccccgggtatttacgctcgtgcttttttagaaggtcgtttaacc
gaagagcaactcgatcattttcgccaagaagtcgaaggaaaaggtctttcttcttatcct
caccctaaattaatgccggaattttggcaattcccgaccgtttctatgggcttagggcct
cttaatgccatctatcaagccaaatttttaaaatatcttgaacacagagtcttaaaagac
acctctaagcaacgggtatacgcctttctaggagacggagaaatggatgaacccgaatcc
aaaggcgctattaccatcgccgctcgagaaaagcttgataatttggtgtttattattaat
tgcaacttacagcgtcttgatggccccgtaaccggcaatgggaaaattattgatgagctc
gaaggcatttttagtggcgcaggttggcaggtcatcaaggtaatttggggagggcgctgg
gatgatctactgagtagagataccagtggtaagctagtccaattgatgaatgaaactgta
gatggcgattaccaaacctttaaatctaaaaatggcgcttatgtacgcgaacactttttt
gggcgatatcctgaaacggcagctttagtcaaagatatgagcgatgatgagatatgggcg
ctcaacagagggggccatgatcctgttaaaatttttgcggccttaaaaaaagcacaggag
accaagggaaaaccaaccctgattctggctcatactattaaaggctatgggatgggtgag
gcgggtgaaggaaaaaatattgctcatcaacttaaaaagatcaatatggaagggatacgc
tatttgagggatcgttttaacatcgctgtcaaagacgaagacattgaaaaattgccttac
gtcacctttgaaaaggagtctgaagaagagaaatatctgcatcatcaacgtcaatcttta
ggcggatatttaccctctcgtttgaaaaatttcacgcaaaaactagagctcccctcactg
caagatttcagcgctctgtttcaagagcaaacaaaacacatctctacgaccatcgctttt
gtgcgcgtattgaatgtgatgttaaaaaataaatttattaaagatcgaattgtgcctatc
atcgccgatgaagcacgtacctttggcatggaagggttgtttcgccaaattggcatttac
aaccccggcggtcagcaatatgtcccgcaggatcgtgaacaagtcgcttattataaagag
gatgccaaagggcaaattttacaggaagggattaatgagctgggcgccgcttcttcctgg
ttagccgcggccacgtcttatagcacgaacgatctcccgatgattcctttttatatctat
tattctatatttgggtttcaacggattggcgatctgtgctgggcagcaggtgatcaacag
gcacgtggatttttgataggcggcacttcgggccgtaccacgctcaatggggaaggttta
cagcatgaagacggtcatagtcacattcaatcgttaaccattccaaattgtatttcttac
gatcctgcttatgcgtatgaagtggctgtcattatgcatcagggccttgaaaggatgtat
ggcgaagcgcaagaaaatgtttactattatttgaccaccttaaatgaaaattatcacatg
cccgcgatgccaaagggagcagaagaaggcataggcaaaggcatttatttgttagaaagt
ctgcctggtaaaaaatccaggcttcagttaatgggatcaggggctattttgcgtcacgtt
cgcgaggcggctcaaattttatctcaacagtatgacattgcctctgatgtctacagtgtg
acttcatttactgaattggcacgtgatggtcaagattgtgagagatggaacatgttgcac
ccagccgaaacaccgaaggtgccttatgttgcccaaattttgcatcaagccccggtgatt
gcctccacggattacatgaaattatttgctgaacaaattcggcctttcattcccactcgt
cattttcgtgttttaggaacagacggttacgggcgttccgatagccgtgaaaatttacga
catcactttgaggtcaatgcggcttatgtggtcattgctgcattgacagagctcaccaaa
ataggggtttttaatcctgaagaagttcaagaagcgatgataaagtttaatatcgatccg
aataaaccaaatccccgtttagcataa

DBGET integrated database retrieval system