KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_2070Help
Entry
HDEF_2070         CDS       T00911                                 

Gene name
asd
Definition
(GenBank) aspartate-semialdehyde dehydrogenase, NAD(P)-binding
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00260  Glycine, serine and threonine metabolism
hde00261  Monobactam biosynthesis
hde00270  Cysteine and methionine metabolism
hde00300  Lysine biosynthesis
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01210  2-Oxocarboxylic acid metabolism
hde01230  Biosynthesis of amino acids
Module
hde_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HDEF_2070 (asd)
   00270 Cysteine and methionine metabolism
    HDEF_2070 (asd)
   00300 Lysine biosynthesis
    HDEF_2070 (asd)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    HDEF_2070 (asd)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     HDEF_2070 (asd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ACQ68636
UniProt: C4K7U3
Position
1895268..1896377
Genome map
AA seq 369 aa AA seqDB search
MKKVGLIGWRGMVGSVLMQRMKETDDFKRLDPIFFSTTESQKGQANPDFSPTMGKIQDAH
HIETLRSLDIILTCQGGEYTNRVYPKLRATGWQGYWIDAASALRMEKDSVIALDPVNLSL
IECALNRGIKTFVGGNCTVSLMLMSLGGLFNASLIEWVSFATYQAASGAGARHMRELLTQ
MGLCYTEVASQLQDPAATILAIEREIMALTRSGDLPTDCFEAPLATSLIPWIDIASENGQ
TREEWKAEVEANKILNNKTMIPIDGICVRIGALRCHSQAITLKLKKDVPIKEIEQILGSY
HEWVKVIPNKKQTTLDRLTPAAVSGTLDVPVGRLRKLSMGPKYLSAFTVGDQLLWGAAEP
LRRMLNLLL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtaggtttgataggttggcgcggcatggttggctcggtattaatgcaacgt
atgaaagaaaccgatgattttaaacgcttagacccgatttttttttccacaacagaatct
caaaaaggtcaagccaatcctgatttttctcctacaatgggcaaaatacaagatgctcat
catatcgaaacattaagatcattagatatcattctgacctgccagggaggggaatatacc
aacagagtttatccgaaattgcgtgccacaggttggcagggttattggattgatgccgcc
tctgcattgcggatggaaaaagacagtgttatagcgctggatcctgtgaatttgagcctg
atcgaatgtgctttaaatagagggattaaaacctttgtcggcggcaattgcaccgtgagc
ttaatgctgatgtctctgggaggattgtttaatgcctctttgatcgaatgggtttcgttt
gcaacttatcaagccgcttcaggggccggggcacgtcatatgcgtgaattattaactcaa
atggggctttgctatacagaagtagcgtcacagctacaagatcccgctgcaacgattctc
gcaatagagcgcgagatcatggcattgacacggagcggcgatcttccaacggactgtttc
gaagcccctttagcaacaagtttgattccgtggattgatatcgcttcagaaaatggccag
actcgtgaagaatggaaagcggaggtggaagccaacaaaattttgaacaataaaacgatg
atccccattgatggcatatgcgtacgtatcggcgctttgcgttgccatagccaggcgatt
acactcaaactaaaaaaagatgttcctatcaaagagatagaacaaattctgggttcttat
catgaatgggtcaaggtgattccaaacaaaaaacaaacgactttagacagactcactccg
gctgcggtaagcggtactcttgatgtgcccgtgggtcgattacgaaaactaagtatggga
cccaaatatttatctgcttttactgttggcgatcaactattgtggggtgccgctgagcct
cttcggcgtatgttgaatttgctattgtga

DBGET integrated database retrieval system