KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_2073Help
Entry
HDEF_2073         CDS       T00911                                 

Gene name
rpiA
Definition
(GenBank) ribose-5-phosphate isomerase A, constitutive
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00030  Pentose phosphate pathway
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01230  Biosynthesis of amino acids
Module
hde_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
hde_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HDEF_2073 (rpiA)
Enzymes [BR:hde01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     HDEF_2073 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind
Motif
Other DBs
NCBI-ProteinID: ACQ68639
UniProt: C4K7U6
Position
1898676..1899332
Genome map
AA seq 218 aa AA seqDB search
MTQDEMKKAVSLVALNYVKSDMIVGIGTGSTVTHFIHALGSIKELVKGAVSSSEDSTRKL
NNIGIPVLDTNEVDIIDIYVDSADEVNHHKQMIKGGGAALTREKVISSMAKKFICIVDHT
KKVNILGQFPLPIEVIPMARSYVARELVKLRGLPEYRQGVITDNANIILDVRHLNMAHPI
HLENKINAIAGVVTVGLFALRPADLVLIATSNTVEIME
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagatgaaatgaaaaaagccgtcagtttggtggctttaaattatgtaaaatcg
gacatgatagtcggaataggaacaggttcaacggtcacccactttattcatgctctaggc
tccatcaaagaactcgtcaaaggagccgtttccagctctgaggattccaccagaaaactc
aacaatatcggtattcctgttctagataccaatgaggtagatattattgatatctacgta
gacagtgctgatgaagtcaatcaccataagcagatgatcaaaggaggaggcgcggcattg
actcgtgaaaaagtcatttcgagcatggcgaaaaaatttatttgtattgtggaccataca
aaaaaagtcaacatattaggtcaattccccttaccaatcgaagtgatcccaatggcgcgc
tcttatgtcgctcgtgagctagtaaaactaaggggattacccgaatatcgccaaggggta
atcaccgataatgcgaatattatattggatgtccgccatttaaatatggcccatcccatc
catttggaaaataaaattaatgcaattgcaggggtcgtcaccgtagggctatttgcactt
cggccagcagaccttgttttaattgcaacatccaatactgtcgaaatcatggagtga

DBGET integrated database retrieval system