KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_2074Help
Entry
HDEF_2074         CDS       T00911                                 

Gene name
serA
Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00260  Glycine, serine and threonine metabolism
hde00270  Cysteine and methionine metabolism
hde00680  Methane metabolism
hde01100  Metabolic pathways
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    HDEF_2074 (serA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HDEF_2074 (serA)
   00270 Cysteine and methionine metabolism
    HDEF_2074 (serA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hde04147]
    HDEF_2074 (serA)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     HDEF_2074 (serA)
    1.1.1.399  2-oxoglutarate reductase
     HDEF_2074 (serA)
Exosome [BR:hde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HDEF_2074 (serA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 ACT_4 IlvN Rossmann-like 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ACQ68640
UniProt: C4K7U7
Position
1899339..1900580
Genome map
AA seq 413 aa AA seqDB search
MATLSPEKSEIKFLLLEGVHQTAVDHLKAEGYSHIEYHQGVLDKLSLKAAIRDTHFIGIR
SRTELCEDIFASAEKLISVGCFCIGTNHVDLNAAAKKGIPIFNAPFSNTRSVAEMALGEL
FIILRGIPAANAKAHRGEWYKQSSSSYEVRGKKLGIIGYGRIGMQLGILAESVGLQVFFY
DIEQKLRVGNAQQVADLRDLLNISDVISLHVPETAMTENMISDKELAQMKRGTLLINTSR
GKVVNIDALYNALKNQHLAGAAIDVFPEEPSSRDEPFQSKLREFDNVILTPHIAGSIEEA
QKNIGNEVAVKLMKYYDNGSTLSSVNFPHVSLPYHRKNTHRLLHIYQNRPGILNRIHQIF
LEQKIRISNQYLQTNAQVGYVMIDVETQTSDKIKETARLMKEIDGTIKLRLLF
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
ttggcaacattgtcacctgaaaaaagcgaaattaaatttttattactagaaggggttcat
caaactgctgtcgatcatttaaaagcagaaggttattctcatattgaatatcatcaaggg
gtattagataagctttcattgaaagcggccattcgtgatactcattttataggcattcgt
tcacgaacggagctctgcgaagatatttttgcctctgcagaaaaacttatctcagtggga
tgtttttgtattggtactaaccatgttgatctgaatgctgcagcaaaaaaggggattccc
atttttaatgcgcctttttcaaatactcgttcagtggcagaaatggcattaggtgaatta
ttcatcattttgagagggatcccggctgccaatgcaaaagcacatcggggtgaatggtac
aagcaatcttcaagttcttatgaagtacgaggtaaaaagttaggcatcataggctatggc
cgtatcggcatgcaattagggattttggcagaaagtgtcgggttgcaagtttttttctat
gatatagagcaaaaattgcgggtgggcaatgctcaacaagtcgctgatcttcgcgatttg
ttaaacatcagcgatgtgatcagcttgcatgttccagaaacagccatgactgaaaatatg
atctcagataaggaattggctcaaatgaaacggggaacactcctcatcaatacgtcacgt
ggtaaggtcgttaatattgatgctctatacaatgctttaaaaaatcagcatctggcggga
gcagccatagacgtttttcctgaagagccttccagtagagacgaaccttttcagtcgaag
cttcgtgaatttgataatgtgatcctgactcctcatatcgctggatcaatagaagaagcc
caaaaaaatatcggcaatgaagtagcagtgaagctgatgaaatattacgataatggctct
acactttcttctgtgaattttccgcacgtctctttgccttatcatcgcaaaaacacccac
cgcttattacatatttatcaaaatcgtcctggtattttaaatcgcatccatcaaattttt
cttgagcaaaaaataagaatttcaaatcaatatttgcaaacaaatgcgcaagtcggctat
gtgatgattgatgttgaaactcagacatccgataaaataaaagaaacagcgcgtttaatg
aaggagatcgacgggacgattaaattgcggttattattttaa

DBGET integrated database retrieval system