KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_2083Help
Entry
HDEF_2083         CDS       T00911                                 

Gene name
prsA
Definition
(GenBank) phosphoribosylpyrophosphate synthetase
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00030  Pentose phosphate pathway
hde00230  Purine metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01230  Biosynthesis of amino acids
Module
hde_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HDEF_2083 (prsA)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    HDEF_2083 (prsA)
Enzymes [BR:hde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     HDEF_2083 (prsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase
Motif
Other DBs
NCBI-ProteinID: ACQ68649
UniProt: C4K7V6
Position
1905731..1906678
Genome map
AA seq 315 aa AA seqDB search
MPDMKLFSGNAIPKLAQRVANRLYTSLGQATVGRFSDGEVSVQINENVRGDDIFIIQSTC
TPTNDNLMELVVMIDSLRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSV
GVDRVLTVDLHAEQIQGFFDVPVDNVFGSPVLIEDMLQQNLANPIVVSPDIGGVVRARAI
AKLLNDTDMAIIDKRRPKANVSQVMHIIGDVAARDCILVDDMIDTAGTLCKAAEALKERG
AKRVFAYATHPVFSGEAAKNIKNSLVDEVVVCDTIPLSKEIKALNNVRTLTLSGMLSEAI
RRISNEESISAMFQH
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgatatgaaacttttttctggtaatgccattcctaaactggctcaacgtgtggct
aatcgcttatatacaagtttaggccaagcgacggtcggtcgttttagtgatggagaagtg
agcgtacaaattaacgaaaatgtgagaggcgatgatattttcatcattcaatctacttgc
actcctactaacgataatcttatggaattggtcgttatgatcgattccttacgtcgcgct
tcagcggggcgtattacagcggtaattccttattttggctatgctcgccaggatcgtcgt
gtccgttctgctcgtgtcccgattactgcaaaagtggtggcggattttttatccagtgtg
ggagtcgatcgtgtattgacagtcgatctacacgcagaacagatacaaggtttttttgac
gttcctgttgataatgtatttggtagccctgttttaatcgaagacatgttgcaacaaaat
ttagcaaaccctattgtggtctctccagacattgggggagttgttcgtgcccgtgctatc
gcaaaattattgaatgacaccgacatggccattatcgataaacgccggcctaaagcgaat
gtctctcaggtaatgcatatcattggagatgtggcagccagggattgtatcttggttgac
gatatgattgacactgcgggcactttgtgcaaagcggctgaagctttaaaggaaaggggg
gcaaaacgggtttttgcttacgcgacacatcctgttttttctggggaggcggcgaaaaat
atcaaaaattcattggtagatgaagtggtcgtttgtgacactattcccctttccaaggaa
atcaaagctttaaacaacgttcgaactttaactttatccggtatgctgtcagaagcgatt
cggcgaatcagtaacgaggaatctatttcagcgatgtttcaacattaa

DBGET integrated database retrieval system