KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_2098Help
Entry
HDEF_2098         CDS       T00911                                 

Gene name
asnB
Definition
(GenBank) asparagine synthetase B
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00250  Alanine, aspartate and glutamate metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HDEF_2098 (asnB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hde01002]
    HDEF_2098 (asnB)
Enzymes [BR:hde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     HDEF_2098 (asnB)
Peptidases [BR:hde01002]
 Cysteine Peptidases
  Family C44
   HDEF_2098 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase
Motif
Other DBs
NCBI-ProteinID: ACQ68664
UniProt: C4K7X1
Position
complement(1919868..1921532)
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVLNLKTDPAELRKKGLEMSRLMRHRGPDWSGVYASDKAILVHERLSIVDTNRGA
QPLYNAKKTHILAVNGEIYNHQALRGKYKERYEFQTDSDCEVILALYQEKGEPFLDELQG
MFTFILYDEEKGTFLIGRDHLGIIPLYMGEDENGTLFVASEMKALVPVCQTLKEFPPGSY
FWSQNKEITSYYQRDWFDYHQVKENTTDPKQLTQALEDAVKSHLMTDVPYGLLLSGGLDS
SIISAITKKFAARRVENNQHTEAWWPQLHSFAVGLEGSPDLSSAKEVAKALGTVHHEIHF
TVQEGIDAIRDVIYHVETYDVTTIRASTPMYLMARKIKAMGIKMVLSGEGSDEIFGGYLY
FHKAPNAQEFHEETVRKLLSLHMYDCARANKAMAAWGVEARVPFLDKHFLDVAMRINPKD
KMCGHGKIEKHILRECFQSDLPAKVAWRQKEQFSDGVGYSWIDSLKEKANQQISDQQLET
AHLRFPHNPPTSKEGYLYREIFQELFPLPSAAECVPGGPSVACSSAKAMEWDASFKDSAD
PSGRAVGEIHQSPY
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctatttttggagtgttgaacttaaaaacagacccagccgaattacgaaaaaaa
gggttggaaatgtcgcgactgatgcgacaccgtggcccggattggtccggtgtttatgct
tctgataaagctattttggtacatgaacgtttatccattgttgacaccaatagaggcgct
caacctctttataacgcgaaaaaaacccatattcttgcagtcaatggtgaaatttataat
catcaagcattacggggaaaatataaagaacgatatgaattccaaacggattcagactgt
gaagtcattttggcgctttatcaagaaaaaggagaaccgtttttagatgagcttcaggga
atgtttaccttcatcctttatgacgaagaaaaaggcacctttttaatcgggcgtgatcac
ttagggattattcccttatatatgggagaggacgagaatggcacactatttgtggcttct
gaaatgaaagcgctggtgcctgtgtgtcaaacattaaaagagtttcctccaggcagttat
ttttggagccaaaataaagaaatcacctcctattatcagagagactggtttgattatcat
caagtcaaagagaatacaacagatccaaaacaactgacgcaggcattagaagatgccgta
aaaagtcatttgatgacggatgtcccttatggattactgctttcaggcggtttagattct
tctattatttccgctatcaccaaaaaattcgcggcacgcagagtggaaaacaaccagcat
actgaggcttggtggccacaactgcattcattcgctgtaggtctggagggctctcctgat
ttatcgtctgcaaaggaagtggcaaaagcgctcggcacagttcatcatgaaattcatttc
actgttcaagagggtatagatgcgatacgagatgtgatttatcacgttgaaacctatgat
gtcaccactattcgtgcgtctacgcccatgtatttaatggctcgcaaaattaaagccatg
gggatcaaaatggtgctctctggtgaaggatcggatgaaatttttggaggctatctttat
tttcataaagcgcctaatgcgcaagaatttcacgaagagacagtacgaaaattactgtca
ttacatatgtacgattgtgctcgagcgaataaagcgatggcagcatggggtgtggaagct
cgagtcccttttttggataaacattttctggatgtggcgatgcgcattaatccaaaagac
aaaatgtgtggtcatggaaaaatagaaaaacatattttacgcgaatgctttcagtctgac
ttgcctgcaaaagtggcctggcgtcaaaaagagcaattttctgacggcgtgggttacagt
tggatagactctttaaaagaaaaggcaaatcagcaaatcagcgatcaacagcttgaaaca
gcacatcttcgttttcctcacaaccctccaacatcgaaagaaggctatttgtatcgtgag
atatttcaggaattatttccgctgccatcggctgcagaatgcgttccaggcgggccttcg
gtggcttgttcttccgcgaaagcaatggaatgggatgcgtctttcaaagatagcgccgat
ccttctggtcgtgcagtaggggagatacatcagtccccttattaa

DBGET integrated database retrieval system