KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_2221Help
Entry
HDEF_2221         CDS       T00911                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase, NAD
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00561  Glycerolipid metabolism
hde00640  Propanoate metabolism
hde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    HDEF_2221 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    HDEF_2221 (gldA)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     HDEF_2221 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH_2 Fe-ADH Vpu
Motif
Other DBs
NCBI-ProteinID: ACQ68767
UniProt: C4K8B1
Position
complement(2008037..2008468)
Genome map
AA seq 143 aa AA seqDB search
MMRNFLFSSPGKNEFGLYLSALGSKVFLIANNAVWTIVEARVKTSLKKADIAYRYKRFNG
ESSQKEIALLAGFTFNEQTSVVVGPGGGKTLDTTKAVADELKPSFAIAPAVASRDASCSA
LLIYTDEGVFDSYRVYHKQHPEL
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaaattttcttttttcttcaccaggaaaaaatgaattcgggctttatctgtcg
gcgctgggcagcaaggtgtttcttattgcaaacaacgcggtctggacaatcgttgaagcc
cgagtgaagacgtctctgaaaaaagccgacatcgcttaccgttataaacgttttaatggg
gagtcatctcaaaaagaaatcgccctcttggcgggtttcacattcaacgagcaaacctct
gtcgttgtcggaccaggagggggcaaaaccctggataccaccaaagcggtggcagacgag
ctgaaacccagtttcgccattgcgcccgcagtggcgtccagagatgcgtcttgcagcgcg
ctgctgatttatacagacgaaggggtgttcgacagctaccgtgtttatcacaaacaacat
ccggaactttag

DBGET integrated database retrieval system