KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_2247Help
Entry
HDEF_2247         CDS       T00911                                 

Gene name
aspA
Definition
(GenBank) aspartate ammonia-lyase (aspartase)
  KO
K01744  aspartate ammonia-lyase [EC:4.3.1.1]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00250  Alanine, aspartate and glutamate metabolism
hde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HDEF_2247 (aspA)
Enzymes [BR:hde01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.1  aspartate ammonia-lyase
     HDEF_2247 (aspA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 FumaraseC_C
Motif
Other DBs
NCBI-ProteinID: ACQ68788
UniProt: C4K8D2
Position
2021751..2023181
Genome map
AA seq 476 aa AA seqDB search
MTKKSFRIEEDLLGKRPVLNSAYYGIHTVRAIDNFQISSHKISDVPELIHGMVMVKKAAA
MANSELGTLSREVADIIIKACDEILINQKCMDQFPVDIFQGGAGTSLNMNTNEVLANIGL
ELMGYQKGQYEHLNPNDHLNQSQSTNDAYPTGFRLAVYVSIGKLIIAIKELHQSFGKKAK
KFFDILKMGRTQLQDAVPMTLGQEFKAFEVLLNEEIKNLERTRKLLLEINLGATAIGTGL
NTPEGYQVLVIKKLCELTQLKFVAADNLIEATSDCGAYVMVHSALKRLAVKMSKICNDLR
LLSSGPRAGLNEINLPQLQAGSSIMPAKVNPVIPEVVNQVCFKVIGNDICVTMAAEAGQL
QLNVMEPVIAQAMFESIQILTNACQNLKEKCIKGITANKEVCEHSVLNSIGIVTYLNPFI
GHHNGDIVGKECAKTGKSVREVVLQKGLLTEAELDNILSVENLMRPRYIAKRHYDD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaaaagctttcgtatagaagaagaccttttaggtaaacgacccgttctcaat
agtgcttattatgggattcataccgtaagggccattgacaattttcagatcagtagtcac
aagattagcgacgtgcctgaacttattcatggaatggtgatggtaaaaaaagccgccgcc
atggcgaacagtgagctaggtacactttctcgcgaagttgctgatatcattataaaagcc
tgtgatgaaattctaattaaccaaaaatgcatggatcagttccctgtagatatttttcag
ggtggtgccgggacttccttgaatatgaatacgaatgaagtacttgctaacattgggttg
gagcttatggggtatcaaaaaggccaatacgagcaccttaatcctaatgatcacctcaat
caatctcaatctacaaatgatgcttatcctacagggtttcgccttgcggtttatgtttct
attggaaaattgatcatcgcaattaaagagttacatcaaagctttggtaaaaaagcaaaa
aaatttttcgacattctaaaaatgggccgcacccagttgcaggatgctgttcctatgaca
ttaggccaggaatttaaggcttttgaagttttgcttaatgaagaaataaaaaatctagag
cgcaccagaaaactattattagaaattaacttaggggctacagcgattggtaccggctta
aacacaccggaaggttaccaggtgctggtgattaaaaaattgtgtgagctgactcaatta
aaatttgtagctgcagataatttaatcgaagccacttcagactgcggtgcgtatgtcatg
gtgcatagtgcgctaaagcgtttagcggtgaaaatgtcaaaaatttgtaatgatttacgt
ttattatcttcaggccctagagcgggattaaatgaaattaatttacctcaactacaagca
ggctcttccattatgcctgcgaaggtcaatcctgtgatcccagaggtggtcaaccaagtc
tgtttcaaagtgattggtaatgatatttgtgtgaccatggcggcagaagcgggccaactt
caattaaacgtaatggaacccgtcattgctcaggctatgtttgaatctattcagattctg
acgaacgcttgtcagaatttaaaagaaaaatgtataaaaggtatcactgccaataaggag
gtttgtgaacattctgttctcaactctatcggtatagtgacttatcttaatccttttatt
ggacaccataatggagatatcgttggtaaagagtgcgcaaaaacgggtaaaagtgttcgt
gaggttgtattacaaaaaggcttactcacagaagcggagctagataatattttatccgtt
gaaaatttgatgcgccccagatacatcgcaaagcggcattatgatgattaa

DBGET integrated database retrieval system