KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_2270Help
Entry
HDEF_2270         CDS       T00911                                 

Definition
(GenBank) conserved hypothetical protein, PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Brite
KEGG Orthology (KO) [BR:hde00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HDEF_2270
Enzymes [BR:hde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     HDEF_2270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: ACQ68811
UniProt: C4K8F5
Position
2042947..2043828
Genome map
AA seq 293 aa AA seqDB search
MIEKKTSIIYDLHSHTSASDGLLTPMQLVHRAVTMGVHILAITDHDTTSGLMAAKKTIQE
QQLPIQLIDGVEISTLWRKYEIHIVGLGIDINHPVIKAFLDKQSERRYERAQKISAALEE
IKIPNVWKGVQDLAGKGLVTRAHFARYLLNLGKGSNIKQIFKKYLVEGKPGYVLPEWGSI
KEAIEIIKKAEGYAVLAHPARYGFSNRLLKVLLAYFADQGGDAMEVAQCQQATHERTLLA
QYANEYHLLASQGSDFHHPCSWIELGRHLWLPAGSEPIWDHWNITVSQPSKMI
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaaaaaagacaagtatcatttatgatcttcatagccataccagtgcatctgat
ggtttattaacacccatgcaattagtgcatcgagccgttacaatgggggttcatattctg
gctatcacggatcatgatacgacttcaggtttaatggcagcaaaaaaaaccatccaggaa
cagcaactcccaattcaattaattgatggtgtggaaatttctactttatggagaaaatat
gaaatacatattgtggggctgggtattgatataaatcatcctgttataaaagcattttta
gacaagcaatcagaacggcgttatgaaagagctcaaaagatcagtgcagcgctcgaagaa
ataaagatccccaatgtttggaaaggagttcaggatttagcaggcaaagggctggtgact
cgagcccattttgctcgctatttactgaatttaggtaaaggctctaatatcaagcaaatt
tttaaaaaatatttggtagaaggcaaaccaggctatgtcttgcctgaatggggcagcata
aaagaagcgatagaaatcattaaaaaagcagaaggatatgctgttttagcgcatcctgcg
cgttatggtttttcaaatcgattattaaaagtgcttctggcatattttgcggatcaaggc
ggggatgccatggaagtcgcacaatgtcagcaggcaacgcatgaacgtacattattagcg
caatatgccaacgaatatcatttattagcctctcagggatcagatttccatcacccctgc
tcctggatagaattaggccgtcatttatggttgcctgcaggatctgagccgatatgggat
cactggaatatcacagtaagtcaaccttcaaagatgatatag

DBGET integrated database retrieval system