KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_2274Help
Entry
HDEF_2274         CDS       T00911                                 

Gene name
hemE
Definition
(GenBank) uroporphyrinogen decarboxylase
  KO
K01599  uroporphyrinogen decarboxylase [EC:4.1.1.37]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00860  Porphyrin and chlorophyll metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HDEF_2274 (hemE)
Enzymes [BR:hde01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.37  uroporphyrinogen decarboxylase
     HDEF_2274 (hemE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: URO-D
Motif
Other DBs
NCBI-ProteinID: ACQ68815
UniProt: C4K8F9
Position
complement(2047642..2048712)
Genome map
AA seq 356 aa AA seqDB search
MKILKNDAYIRALLRESVDITPVWMMRQAGRYLPEYKKIRAQAGDFMSLCKNTQLACEVT
LQPLRRYPLDAAILFSDILTIPDAMGLGLYFTTGEGPKFHFPIRMKADIEKLPIPDPEKE
LRYVMDLARTVRKELAGTVPLIGFAGSPWTIATYMVEGGSSKIFSRLKAMLYTEPATLHL
LLNKLTQTVILYLNAQIQAGVQSIMIFDTWGGVLSGENYRIFSLNYMHQIIEGLTRENEG
CKIPVTLFTKGGGQWLEAIAETGCDAIGLDWTTDIGEARHRVGDKVALQGNMDPAVLYAP
APIIEKEVASILGAFGKGTGHIFNLGHGVHQDTPPEHVRIFVDAVHRLSKNDAASG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcttaaaaaatgacgcttatattcgggcgttattgcgagaatccgttgatata
acgcctgtttggatgatgcgtcaagctgggcgctatttacctgaatacaaaaaaatacga
gcgcaagcgggcgattttatgtctctgtgtaaaaacacacaattggcttgtgaagtcacc
cttcagcccttacgtcgctacccattagatgcggctattttattttctgatattttgacg
attcccgatgccatgggattgggactttattttacaacaggcgaaggcccaaagtttcat
tttcctattcgcatgaaagcggacatagaaaaactccctattcctgatccagaaaaagaa
ttgcgatatgtgatggatttagcacgcactgttcgaaaagaattggcaggcacggtgcct
ttgattggatttgcaggcagcccttggacaatagcgacctatatggtcgaaggtgggagc
agcaaaatcttcagtcgattgaaggccatgctttataccgaaccggccaccttgcatcta
ttgttgaataaactgactcagactgtgatcctctatctgaatgcacaaattcaagcaggc
gttcaatctattatgatattcgatacctggggcggggtattaagcggagaaaattatcgt
attttttcattaaattacatgcatcagattattgagggcctaacgcgggaaaatgaaggt
tgcaaaataccggtgaccttatttactaaaggcggcggacagtggttagaagccatcgca
gaaacgggttgtgatgcgataggactcgattggacaaccgacattggagaggcccgtcac
cgtgtaggagacaaggttgcattacaaggaaatatggatcccgctgttttgtatgcccca
gcacctattattgaaaaagaagtcgcctctattttaggggcttttggaaaaggaacgggg
catatttttaatttaggccacggcgttcatcaagacacccccccagagcacgtgcgtata
tttgtagatgcggtacatcgtttatcaaaaaatgacgctgcgtcaggatag

DBGET integrated database retrieval system