KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_2304Help
Entry
HDEF_2304         CDS       T00911                                 

Gene name
icdA
Definition
(GenBank) isocitrate dehydrogenase, specific for NADP+
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00020  Citrate cycle (TCA cycle)
hde00480  Glutathione metabolism
hde01100  Metabolic pathways
hde01110  Biosynthesis of secondary metabolites
hde01120  Microbial metabolism in diverse environments
hde01130  Biosynthesis of antibiotics
hde01200  Carbon metabolism
hde01210  2-Oxocarboxylic acid metabolism
hde01230  Biosynthesis of amino acids
Module
hde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hde_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDEF_2304 (icdA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HDEF_2304 (icdA)
Enzymes [BR:hde01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     HDEF_2304 (icdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ACQ68842
UniProt: C4K8X3
Position
2071793..2073046
Genome map
AA seq 417 aa AA seqDB search
MNSKVIVPPKNKAQKICFDGKLIVPDHPVIPFIEGDGIGVDITPAMINVVDAAVERAYNS
KRKIAWMEIYAGEKSTQIYGKDVWLPDETLDLIRQYHVAIKGPLTTPIGGGMSSLNVALR
QKLDLYVCLRPVRYYTGTPSPLKQPELTDMVIFRENTEDIYAGIEWKAGSEDAKKVIEFL
QKQMGIQKIRFTENCGIGIKPCSKQGSERLIRAAIQYAIDNDRASVTLVHKGNIMKFTEG
AFKEWGYELAREEFNGKLFNGGPWLEIKNPKNGKSLIVKDVIADAFLQQILLRPKEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANLNEQCALFEATHGTAPKYAGQDKVNPGSLILS
AEMMLRHMGWTQAADLIIEAMQRTFSAKTVTYDFHRLMEGATLNKCSEFAQNIIKNM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaaagtcattgttccacctaaaaataaagcccaaaagatttgttttgatggc
aagttaatcgttccagatcatcctgttattccctttattgaaggggatgggattggcgtt
gatatcacgccagctatgatcaacgtggtcgatgcggcggttgagcgggcttataatagc
aaaagaaaaatcgcctggatggaaatttatgccggtgaaaaatcgactcaaatttatgga
aaagacgtttggttacccgacgaaaccctggatttgattcgtcaatatcatgttgcgatt
aaaggaccactgacaacgccaataggaggtggcatgagttctttaaacgtcgcattacgg
caaaagctcgatctttatgtttgtttacgtccagttcgttattacacgggcacacctagc
ccacttaagcagcctgaattaacggacatggtgatttttcgtgaaaacacggaagatatt
tatgcggggattgaatggaaggccggttcagaagacgccaaaaaagtgattgaatttttg
caaaaacagatggggatccaaaaaattcgattcaccgaaaattgcggcattggcattaag
ccttgttcaaagcaggggagtgaacgactgatcagagcggccattcaatacgccatcgac
aacgatcgtgcatctgtcaccctggtgcataaaggcaatatcatgaaattcacggaaggg
gcatttaaagagtggggctatgaattggcacgtgaagaatttaacggaaaattatttaat
ggcggcccttggcttgaaatcaagaatcctaaaaatggaaaaagccttattgttaaggat
gtgattgcggacgcctttttacagcaaatattactacgccccaaagaatatgatgtgatc
gcctgtatgaatctcaatggcgattatatttctgatgcattagcagcacaggtgggcggc
attgggattgcgcctggggcgaatctcaacgaacaatgtgcattatttgaagccactcat
ggaacggcgccgaaatatgcggggcaagataaagtcaacccaggctcgctgattttatca
gctgagatgatgttgaggcatatgggatggacgcaagccgccgatttaatcattgaagcg
atgcaacgcaccttttctgcgaaaaccgtgacatacgattttcatcgtttgatggaaggt
gccacattaaataaatgcagtgaatttgctcaaaatatcattaaaaatatgtaa

DBGET integrated database retrieval system