KEGG   Candidatus Hamiltonella defensa (Acyrthosiphon pisum): HDEF_2331Help
Entry
HDEF_2331         CDS       T00911                                 

Gene name
gshA
Definition
(GenBank) gamma-glutamate-cysteine ligase
  KO
K01919  glutamate--cysteine ligase [EC:6.3.2.2]
Organism
hde  Candidatus Hamiltonella defensa (Acyrthosiphon pisum)
Pathway
hde00270  Cysteine and methionine metabolism
hde00480  Glutathione metabolism
hde01100  Metabolic pathways
Module
hde_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:hde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HDEF_2331 (gshA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HDEF_2331 (gshA)
Enzymes [BR:hde01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.2  glutamate---cysteine ligase
     HDEF_2331 (gshA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_cys_ligase
Motif
Other DBs
NCBI-ProteinID: ACQ68868
UniProt: C4K8Z9
Position
complement(2098142..2099710)
Genome map
AA seq 522 aa AA seqDB search
MNVIPDVSQALSWLEAHPKVLKGIRRGIERETLRVTPNGHLAMTIHPKVLGAPLTHPWIT
TDFSEALLEFITPADQDIQKSLMFLRDLHRYTARQLMNERFWPLSMPCFIETEEDIPLAQ
YGSSNLGRFKTLYREGLKNRYGALMQTICGVHYNFSLPLAFWQTKEGIEDEKKGKNVISD
GYLRLVRNYYRFGWVIPYLFGGSPTVCSSFLREKKSSLAFETFGKNTLYLPYATSLRLSG
LGYTSAAQSNLKMNFNDLNIYVNDLKKATRIPSKEYAKIGLKNKNRYLQLNTNVLQIENE
LYAPIRPKRSTEIGELPSDALLKGGIEYLEIRSLDINPFSPIGINETQIRFLDLFLIWCV
LAPSNEMSDEELLYTQKNWEKVILEGRKPDQVLNIGTERNPQSIKRIGKTLFQGLTRIAE
IIDEKDKKYQKACDELLMYLEDPDLTFSARFLKEIKANQGESIGLKRAEKYFEQLKKEPL
ELLTEAQLCDESRSSCQRQAELERGDTISFEEYLRLHSGRYR
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtgatcccagacgtatcacaagcgctttcttggttggaagcacatccaaaggta
ttaaaaggcatccgacgaggtattgaaagagaaacactaagagtgacacccaatggtcac
ttggcaatgacaattcatcctaaagtgttaggggctcctctcactcatccatggatcacc
actgatttttctgaagccctattagaatttattactcctgctgatcaggatatccaaaaa
tcgttgatgtttttacgcgatcttcatcgttacaccgcgcgtcagttaatgaatgaacgt
ttctggcctttaagcatgccatgttttattgaaactgaagaagatattccgttggctcaa
tacggttcttctaacctggggcgttttaaaacgctttatcgcgaaggcttaaaaaatcgc
tatggggcattgatgcaaaccatttgtggtgttcactataatttttctctgccattggca
ttttggcaaacaaaagaaggcatagaagacgaaaaaaaagggaaaaatgtcatttccgac
ggctatcttcgcttagtgcgtaactattaccgttttggctgggtgattccttatttattt
ggtggatcccctacagtgtgctcttcatttttaagagaaaaaaaatcctctctggcgttt
gaaacatttgggaaaaatacgttatatctgccgtatgccacctctttacgtttaagtggt
ttaggctataccagtgccgctcaaagcaatttaaaaatgaattttaatgatttgaatatt
tatgtgaatgatttaaaaaaagccactcgaattccttccaaagaatatgcaaaaatcggt
ttaaaaaataaaaatcgttatttgcagttaaataccaatgtattgcaaatagaaaatgaa
ttatatgctcccattcgacctaagaggagtactgaaataggtgagcttccttccgatgct
ttattgaaaggagggattgaatatcttgaaatccgttctttagacatcaacccattttca
cctatagggataaatgaaacgcaaattcgttttttggatctttttttaatttggtgtgta
ttggcgccctccaatgagatgagcgacgaggaattactttatactcagaaaaattgggaa
aaagtgatattggaagggcgtaaacccgatcaagtgctgaatatcggtaccgaaagaaac
cctcagtctatcaaaagaataggaaaaaccttgtttcaaggtttaacacgaatagcagaa
atcatcgatgaaaaagataaaaaatatcaaaaagcgtgcgatgaactgctgatgtatctt
gaagatcctgatttgactttttctgctcgttttcttaaagaaataaaagcaaaccaaggc
gagagcattgggcttaagcgtgccgaaaaatattttgaacagcttaaaaaagagcccctt
gagctacttacagaagctcaattatgtgatgagtctcgttcatcatgtcaacgccaagct
gaactagagcggggggatactatcagttttgaggaatatctgcgacttcactccggtcgt
tatcgttaa

DBGET integrated database retrieval system